SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G29660.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G29660.1
Domain Number 1 Region: 496-807
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-82
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 88-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-20
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G29660.1
Sequence length 888
Comment pep:novel chromosome:ALNW00000000:1:31003776:31020963:1 gene:OMERI01G29660 transcript:OMERI01G29660.1 description:""
Sequence
MEKATSWALKAAMMRTKSSCRKVITLLMIALWLARCLGRDSISVNESLSDGQTIVSMKNV
FVLGFFSPGAPSHRYVGIWHNSLGNSTVVWVGNRNEPLSDASGVLMFDSNGNLVIAHGGR
SLIVAYGKGAKDMKATILDSGNLVLSSMANRSRYMWQSFDSPTDTWLPEMKIGLRTANQS
LISWWSNDDPAVGDYTLAMDPSGLTPPGLTQLIIWWKETIYWSSGKWNSSELSLIPQLAS
FTPISIFFRCSNFTNDISCTYSANPSDRMTKILLNPAGSLNIMQFDSLAQVWILVWSVPS
TCEVHNLCGAFGVCNNSRVLKCVCTRGFVPRDLAAYSSGNTWKGCTRKIKLQCSSDEFHE
IPNARLPDNGKKLTVTGLRECKLASYAYSQLDGCSLWYGDLLNLQDSYDVNGARTLCLRL
AKSELEYGGSSGSGHKILWMAVVFPSMALLFFCSLSFILWRRCQKEGKEKSHPHHPLTTL
GMDSEVKLWDSEEAGSHFVFFSFSQIANSTTNFSAQNKLGEGGFGPVYKGSLPDGQDIAV
KRLATNSAQGLVEFKNEVLLIAKLQHVNLVRLLGCCIQGEEKILVYEYMPNKSLDFFLFE
KSRRIILDWRKRVHIIEGIAHGLLYLHKHSRLRIVHRDLKASNILLDIDMNPKISDFGMA
RIFGSKETEANTNRVVGTYGYMAPEYAMQGVFSVKSDVFSFGVLLLEIVSGMRNAGSHRR
GRSLNLLGHAWELWREGSWFDLVDPSIRDAYPEHRVLRCVHVGLMCVQENAVDRPTMSDV
ISMLTSESITLPDPRQPAFLSIVLSAEMDAHDGSFSQNAMTITDLEVWRNILVTASEITK
HGEIRDWIDGREDRSYNRMELGKREAGVGADGIMEGPMIIQGTADCYD
Download sequence
Identical sequences OMERI01G29660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]