SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G29680.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G29680.1
Domain Number 1 Region: 533-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-80
Family Protein kinases, catalytic subunit 0.0000836
Further Details:      
 
Domain Number 2 Region: 84-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.81e-25
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  OMERI01G29680.1
Domain Number - Region: 364-426
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0126
Family Hairpin loop containing domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI01G29680.1
Sequence length 864
Comment pep:novel chromosome:ALNW00000000:1:31046314:31050929:1 gene:OMERI01G29680 transcript:OMERI01G29680.1 description:""
Sequence
MIGRFGDKRDMRRRRALALLLVTMAFFSRPVIAVDRIGLTASIIGKSTLESAKGVFKLGF
FTPPGGKGTYLGIWYANIQSDLTVVWVANRQHPVINAPGVVTLSANGLVIVDAQNTTVWS
SPVPAGAVTAGATARLHDDGNFAVSSDGRDSQSVVWQSFDYPTDTLLPGMKLGEDRKKGI
TRNITSWSSPTDPSPGKYTFKLVLGGLPEFFLFDNSKTTPVYASGPWNGEILTGVPGLKS
QQAKGDFTFTVLSSPEETYYNYSISNRNPSFLTRFFVDGTEGKLQRIWSSDDGKSWINNK
NSYPIDPCDNYGSCGAFGYCVYTEGQPQQCNCLPGFQSRSAQGSFQDTSKGCARITNLTC
GDGDGFWRVNRMKLPDATKATVHAGMTLDQCRQECLRSCSCNAYAAADVSGGVNRGCVIW
TVGLMDMRKYPEFVQDLYIRLPQSQIDALNAPARRRRLIKNVVIAVVTTICGILGIVGCC
CLWRNKTRWKRHSRIGKSSEASDIPFRVRKNPASSPARDQWFDENNTSVEDDLDLPLFDL
EMIFDATDRFAANNKIGEGGFGPVYLGRLEDGQEVAVKRLSRTSVQGVVEFKNEVKLIAK
LQHRNLVRLLGCCIDDNERVLVYEYMHNKSLDTFIFDEGNRKLLSWNKRFEIILGIARGL
LYLHEDSRFRIIHRDLKASNVLLDRNMVPKVSDFGIARMFEGDQTTAYTRKVIGTYGYMS
PEYAMDGVFSMKSDVFSFGVLVLEIVAGRRNRGFCESELNLNLLRYAWMLWKEGKSMNLL
DELIGDIFDDIEVLRCIHVALLCVEVEPKNRPLMSSVVMMLASENATLPQPNEPGVNIGK
ITSDTESSHGFTSNSVTITTIEAR
Download sequence
Identical sequences OMERI01G29680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]