SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G30890.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G30890.1
Domain Number 1 Region: 420-742
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-75
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 13-151
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-16
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 
Domain Number 3 Region: 113-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000302
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  OMERI01G30890.1
Domain Number - Region: 308-348
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00286
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G30890.1
Sequence length 751
Comment pep:novel chromosome:ALNW00000000:1:32126266:32128521:-1 gene:OMERI01G30890 transcript:OMERI01G30890.1 description:""
Sequence
MAAADPVQQKAAVVWHATDPDGSGSAVTATTQSVFSVNFGQLSLANNGSRNIWTNVNPAQ
PNGFVLVLLDSGNLQFLTGGDNSVVWESFRHPTDTLLPGQSMGAGENLRSKRTDADFSAG
RFGLFVQADGNIVLYIGGHADSSRAYWATRTQQPGNTQDGNTTLFFASTGSIYYQIKNGS
LYDLTPPMASSTAGGSYRRATLDPDGVVRVYIRPRSSANASWTVADLFPAVGCGMSTRAL
DGFCGPNSYCVVSGADSRLDCACPSNYSFIDKNIRYEGCRPAFAPQSCDVVNSSAEFEIT
KLPNTTWTTSPYMIYERMAEEQCADICLRDCFCVAALFEPGATRCTKMALLAGSGRQERS
VTQKALIKVRTSRSPPAPPSRGRVPLLPYIILGCLAFLIILAAATSLLLHWHMRRINNDH
DIVRHFTKKELHRATNGFRRLLGRGGFGEVYHGVAKSLHPPDIAVKKLVTSNEYSEREFA
NEVQSIGRIHHRNLVRMLGYCKEREQRMLVFEFMPGGSLRSFLFQTPRPPWSWRAEAALG
IAKGIEYLHEGCTLPIIHCDIKPDNILLDDRNNPKITDFGIARLLGDQQMYTTVTNVRGT
RGYIAPEWFHSERRIDTKVDVYSFGVVLLEMICCRRCQDPVTSRGEGGDDHDNSVVTLFG
WASQLVNHGRVEVILHSDDDAVEDLERVERFVRVAFLCIETNPSLRPMMHQVVQMLEGVV
EVHAMPHLPSSIDTLPSISKDSRTPRFFFSS
Download sequence
Identical sequences OMERI01G30890.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]