SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G35130.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G35130.1
Domain Number 1 Region: 487-790
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.77e-74
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 66-160,193-223
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-27
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  OMERI01G35130.1
Domain Number - Region: 364-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00208
Family Pan module (APPLE domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI01G35130.1
Sequence length 827
Comment pep:novel chromosome:ALNW00000000:1:36037776:36041009:-1 gene:OMERI01G35130 transcript:OMERI01G35130.1 description:""
Sequence
MAPPCSSALVLPCLLVVIAMAALQSAVVFADTVTAKRPLSGSQSALVSKRRKFALGFFQP
ENSQHWYLGIWYNQISKHTPVWVANRASPISNPDTSQLTIATDGNMVFLDNSTTAIWSTN
ISKITSDSTVGVILDTGNLVLADASNTSIIHWQSFDHFGNTWLPGGKLGRNNKLAGVSTR
LVAWRARNDPSPGVFSLELDPNGTSQYLLEWSITKQYWTSGNWTGRIFADVPEMTGCYPS
SAYTFDYVNGENESESYFVYDLKDESVLTRFFLSEMGQIQFLTWIYAAKDWMPFWSQPKV
KCDVYSLCGPFSVCTENALTSCSCLRGFSEQNAGEWLQGDHTSGCRRNVELQCSSNGSVM
ESTDGFYTMADVRLPSNAESVMVIGNDQCEQACLRSCSCTAYSYNGSCSLWHGDLINLQD
VSAISSQGSSTVLIRLAASELSGKKQKHTKNLITLAIVATSVLVLILAVLVFIFIRRMVK
EITRVVEGSLIAFTYRDLKSMTKNFSEKLGGGAFGSVFKGSLPDATMVAVKKLEGFRQGE
KQFRAEVSTIGNIQHVNLIRLLGFCSEKSRRLLVYEYMPNGSLDKQLFDSKKHVLSWDTR
YQIALGIARGLDYLHEKCRDCIIHCDIKPENILLDGSFAPKVADFGLAKLMGRDISRVLT
TARGTVGYIAPEWIAGTAVTAKADVFSYGMTLLEIVSGRRNVQGRRRQEQHDGVGAAADR
PFPLVAAGRLVGGGGGGGRREELVSAVVDCRLGGDADMGEVERACRVACWCIQDDENARP
AMATVVQVLEGLVEIGVPPIPRSLQFLAELADQSNYLLFFSDLLPSN
Download sequence
Identical sequences A0A0E0CAW3
OMERI01G35130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]