SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G36010.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G36010.1
Domain Number 1 Region: 507-737
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-32
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 65-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-27
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  OMERI01G36010.1
Domain Number - Region: 344-395
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00126
Family Anti-platelet protein 0.024
Further Details:      
 
Domain Number - Region: 213-290
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0406
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G36010.1
Sequence length 753
Comment pep:novel chromosome:ALNW00000000:1:36785799:36788294:1 gene:OMERI01G36010 transcript:OMERI01G36010.1 description:""
Sequence
MADNPPLIMILAFLVSALLLLLSPAHGGSRLRRGESLSVERASDILVSSNGVFAFGFYNL
SSTVFTVSVWFAASAGRTVAWTANRDRPVHGAGSKLTLRRDGRLVLTDYDGTPVWQTNSS
SGSAAAAELTDSGNLVVTSHDGDVLWQSFDYPTDTLLPGQPVTATARLSTTDVLHPTSHY
ALRFDDRYLLSLAYDGPDISNIYWPDPDASSWANGRISYNASRRGVLDDAGRFLASDNTT
FVASDMGAATGGVTWRRLTLDHDGNLRLYSLRDADGGWSVSWMAFSQPCSIHGLCGWNGL
CVYTPRPACSCPPGYVPADAGDRGKGCRPTFNLTCGGGGRPAMGFARLPQTDFWGSDLNL
VSSISVDGCKAACLELCNCVAFEYKDDVSDCYLKSALFNGKTYPGYPGTVYLKLPANLVA
ESDTYTTAPATTAAAVNLACDDARTEGVLLLSFPSASPDDGGTSSWRYYYGFLSAFFAVE
LCFIAFGWWFTARSRPATSEQWAAEEGYRVVTDHFRRFTYGELRKATRNFKDVIGHGRYG
SVYRGVLAAGAGAGGDRAVAVKKLKATTPQRGDDEFETEVSVIGRINHMNLVRIRGVCSE
RHRRRRLLVYEYVDNGSLATWLFGAKETLNWNQSLPITEKVDVYSYGVVLLELVRGARMA
DLATDSVGDAEIATRQLVWKIREGLKSGDRTWVISLVDHRLNGSFMYSQVALMLEVATAC
LEKERTQRPSMNDVVKKFYTSDKKVEFIGEMSS
Download sequence
Identical sequences OMERI01G36010.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]