SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G36330.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G36330.1
Domain Number 1 Region: 73-169,201-232
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-29
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Domain Number 2 Region: 499-592
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.73e-17
Family Protein kinases, catalytic subunit 0.003
Further Details:      
 
Domain Number 3 Region: 829-950
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.000000000461
Family Single-domain sulfurtransferase 0.04
Further Details:      
 
Weak hits

Sequence:  OMERI01G36330.1
Domain Number - Region: 590-691
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00116
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 
Domain Number - Region: 388-429
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0294
Family Pan module (APPLE domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G36330.1
Sequence length 1040
Comment pep:novel chromosome:ALNW00000000:1:37010493:37017361:-1 gene:OMERI01G36330 transcript:OMERI01G36330.1 description:""
Sequence
MAAARGGGRRPSCGSPFLMMLIGCLLWLHREAAPSLAADTVAVGRPLSGGQVLVSKGGKF
ALGFFQPDNSSQRWYMGIWYNKIPDHTKVWVANRRAPLSDRDTSRLAISADGNMVLLDRA
RSPVWSTNVTTGVAANSTVGVILDTGNLVLADASNTSVVLWQSFDHFGDTWLPGGRLGRN
KLTGEVTRLVGWKGYDDPTPGMFSLELDPGGASQYVMSWNGSSRLYWSSGNWTGGMFSSV
PEMMASNADPLSLYTFNYVDGENESYFFYDVKGEVVLTRFVVDVTGQIKFMTWVDSAAQW
VLFWSEPKAQCDVYSICGAFGVCAEDALPACSCLRGFHARQPRQWLQGDHTAGCARTTAL
QCGGAQPAAQKTKSDRFFVMPNVNLPTDGVTAASASASASARDCELACLGNCSCTAYSYN
GSCSLWYGDLISLRDTTGAGNGSGRSISIRLAASEFSGNGNTKKLIIGLVVAGVAAAVIL
AVVVTVLVRRSRRMKALRRVEGSLAAFTYRDLQVVTKSFSEKLGGGAFGSVFKGSLPADG
TPVAVKKLEGVRQGEKQFRAEVSTIGTIQHVNLIRLLGFCTERTRRLLVYGMMLFEIISG
RRNVEQGQDGAVDFFPATAARLLFDGDLKGAVDGRLAGNADMGEVERACKVACWCVQDSE
ATRPSMGMVVQVLEGLVDVNAPPMPRSFKVLGDPSNYVKELMPLAGMALLQLREHCSLLP
NPLRPARNPRKNRLLPPNAAKVPGFSRISIHGAPPAPKAAILEERVEAAVVPWRGAFPFP
VAAAVVASWPLPSLAAEAGGKVSLESIVVAIDDFNNRNPFFVAGAVFVWLVAIPLVQEYF
KKYKAVSAIDAFRKVRDEPGAQLLDIRRGKSVRFMASPNLRLVEKSAVQVEFDEEDEEGF
VKEVLARFPDPANTVVCVLDNFDGNSMKVAELLFNNGFKEAYAIKGGLRGPEGWQAIQEK
YLPPSVHVVPRKKSKESEDSDVSVDGTDDQLEANGKLLATPNSSVVNTGNGAEDSTEKPN
GSTSAIKHASRRPLSPYPNV
Download sequence
Identical sequences OMERI01G36330.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]