SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI01G36350.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI01G36350.1
Domain Number 1 Region: 845-1128
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-76
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 138-346
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-65
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 427-524,556-586
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-29
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  OMERI01G36350.1
Domain Number - Region: 727-775
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0279
Family Anti-platelet protein 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI01G36350.1
Sequence length 1153
Comment pep:novel chromosome:ALNW00000000:1:37023128:37031065:1 gene:OMERI01G36350 transcript:OMERI01G36350.1 description:""
Sequence
MSGQTQAWVWVDAAQAWVLYFSQPKLMCGVYGICGAYSKCSSNAVLSCTCLKGFSESPRN
GNPGNQTAGCRKNVPLQCGHSDSAKVKNQDGFYMIGGAHLPGKAQGTDAANVHSCWLPQN
FLTQEGRNIGIGIIIVGLTVFITRNFTEKLGAGSFGSMFKGIIPDTATVAVKRLEGLRQG
EKEFRAEVSTIGKIHHKNLIRLLGFCCGGSKMLLVYEYMPNGSLDQHLFGKSNLTLSWTT
RYQIAVGIAKGLAYVHEGCRDCIIHCDIKPQNILLDESFVPKVADFGLSKLIGHDFSRVL
TSMRGTLGYLAPEWLSGQAITSKAHVFSYGMMLFEIISGKRNIEHGASTSSSMLIAEEIP
KGGEVHRLFDPELVGDSNPEELDRSPLHAADTLTAEQPLSGDQKLISQDGKFALGFFQPA
AGGSSSRWYIGIWYNKIPVQTVVWVANRDKPITDPASSNLTILNDGNIVLLVNHSESPVW
STNIANNTIASSPVAVLLDSGNLVVRHESNTSEVLWQSFDDFTDTWLPGNKLSRNKKTGV
IKRMISWKDRADPAPGMFSIQLDPSGATQYILLWNSSSVYWASGNWTGNTYTGVPELSPT
NSDPNSAYTFQFVDNDQETYFNYTVKNDAQLTRGVIDVSGHFQAWVWADAAQAWQLFFAQ
PKAKCSVYGMCGAYSKCSENAELSCSCLKGFSESYPNSWRLGDQTAGCRRNLPLQCGNNG
SVKAKQDRFFMISSVKLPDMAHTRDVTNVHNCELTCLKNCSCSAYSYNGTCLLWYNGLIN
LQDNMGELSNSIFIRLSASELPQSGKKKWWIVGIIIGGLVLSSGVSILYFLGRRRTIGIN
RDDGKLITFKYNELQFLTRNFSERLGVGSFGSVYKGILPDATTLAVKKLEGLRQGEKQFR
AEVSTIGNIQHINLIQLLGFCSEGAKRLLVYEYMPNGSLDHHLFQNNSAISSWKRRYQIA
IGIAKGLAYLHDGCRDCIIHCDIKPQNILLDMSFTPKVADFGMAKLLGRDFSRVLTSIRG
TIGYLAPEWISGESITTKADVFSYGMMLFEIISRKRNLTQTETRTEIFFPVLVARKLVQG
EVLTLLDSELVDDANLEELERACKVACWCIQDDESSRPTMAEVLQMLEGLVDIEVPPAPR
YLQVLAEGAASKT
Download sequence
Identical sequences OMERI01G36350.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]