SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI03G19630.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G19630.1
Domain Number 1 Region: 504-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-71
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 957-1246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-59
Family Extended AAA-ATPase domain 0.062
Further Details:      
 
Domain Number 3 Region: 61-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.2e-27
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Domain Number 4 Region: 1295-1608
Classification Level Classification E-value
Superfamily L domain-like 1.29e-20
Family Internalin LRR domain 0.02
Further Details:      
 
Weak hits

Sequence:  OMERI03G19630.1
Domain Number - Region: 340-386
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000942
Family Pan module (APPLE domain) 0.035
Further Details:      
 
Domain Number - Region: 212-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00602
Family alpha-D-mannose-specific plant lectins 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI03G19630.1
Sequence length 1646
Comment pep:novel chromosome:ALNW00000000:3:18815732:18822197:1 gene:OMERI03G19630 transcript:OMERI03G19630.1 description:""
Sequence
MAPFFSILPALSFLALLPIVMSRDKLPLKSSLSVDDYQNDVLQSADGTFSCGFLTIYSNA
FTFSIWYTNSKNKTVVWTANRGRPVHARRSVVTLQKDGAMVLKDYDGTVVWQSDSNSIDV
QYAQLLDTGNLVMKTSSGKVVWKSFDSPTDTLLPTQYITATTKLVSTTGLYVPGHYTFHF
TDSSILSLMYDDADVHEIYWPDPDRGEYQNKRNRYNNTRMGFLDDNGDFVSSDFADQQPF
SASDKGSGIKRRLTLDHDGNLRLYSLSNGEWSVSWVAISQPCNIHGLCGPNGICHYSPTP
TCSCPPGYEMNSHGNWSQGCKAIVDISCSVAKVQFKFVHLPDTDFWGSDQQLVNHVSWQA
CMNICRSDCNCKGFQYLKGEGTCFPKSFLFNGRAYPSHFVSPRNMYLKIPVSTNISGMPV
PQSNVLDSRKHSLNCGQMDGKTREPFPDVHKTSQGETRWFYLYGFAGAIFILEVCFIAFA
WFFVSRWDLDALEIQAVEQGYKVMASNFRRYSYKELAKATRKFKYELGRGGSGIVYKGTL
DDGRVVAVKMLENVRQCEEEFQAELRIIGKINHMNLVRIWGFCSENSHRMLVTEYIENGS
LANILFNENILLEWRQRFNIAVGVAKGLAYLHHECLEWVIHCDVKPENILLDGNLEPKIA
DFGLAKLLNRGGSNHNVSRVRGTIGYIAPEWISSLQITAKVDVYSYGVVLLELVSGKRVL
DFGYKRLVKMFANNLSGNEPSWIAEFVDCRLNGQFNYSQQLRCTAGAGVDRPTRAPPLTP
APSGIHSNPSISKRVDLVTLLYKSSYARSYTTTSMKMLRLLGGVRGELQYIKDELESMNA
FLQNLAATSSHGGQVKIWMKQVREMAYDAEDCVDEFQHHFGGYCHNGIVGFLYRMKHLMY
ILKARHRIVMQVQELKVRARDVSDRYARYSGANAIVAASDSKNTTTSISTCLSLDPRQVI
GFIQDDLLVGINNRRDRVLTYLRVDSDQELRVISIFGFGGLGKTTLAKAIYDSPQVKNGQ
FHCQAFVTISQKIDLKALLRDMLGQLIPPASDQHVSSDIEDEHLKAIEVWDVKRLGDKLR
SYLDDKRYLVILDDIWSDSAWDTFKFLLPKNHVGSVIIVTTRIRSVANYCSHLQHDYSYE
IEPLNEIESKELFLRRLFGQLHECPQNIQKVSESVLKKCGGMPLAINSIVGLLASRPVKS
LEEMQNLQNSLGSEMDSFSTMEKIKQILLLSYNDLPYHLKTCFLYFSIFPEDYKIKRKNV
VQQWVAEGFVSNKRGQSAEQVAESYFAEFINRSIVQPLDISDSGKVRTCRIHDIMLEVIV
EMSVEQNFISLMGDQHTMISYDKVRRLSLHGYGAYNLSTSLELSHIRSLSSFGDMPRALR
FDCARLLRVLDLESCEFLRNRQLHQICALFHLKYPSVRRAHNIDRLPRKIKKLQSLETLD
LRGTGSTYLPHGFGRMKSIQTLGLIEITDDTSWRIQEIGCLMQLEKLRIRLLLYGSLEAL
PSWMASLDNLVKLTLGGTKLKEDDIQILQKLPRLFSLRLWFAFAVEKFVVAPSGFPNLQL
LAIQGWNGPLQMILEEGAMQKLHKLVLVASFRDATLKSIKGTKYLRSLRTVEIRAKSTPC
MEALLDELRLEASHLPNHPIVIFKRA
Download sequence
Identical sequences OMERI03G19630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]