SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI03G35980.4 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI03G35980.4
Domain Number 1 Region: 496-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-70
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 76-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-17
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Domain Number 3 Region: 177-276
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000301
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  OMERI03G35980.4
Domain Number - Region: 294-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00533
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI03G35980.4
Sequence length 827
Comment pep:novel chromosome:ALNW00000000:3:36919848:36922781:-1 gene:OMERI03G35980 transcript:OMERI03G35980.4 description:""
Sequence
MFPHILFLSLLLLVPEDPNFAAGASANESFITLGSSINTSSTQYWSSSSGRFAFGFYPNG
EGFSIGVWLVIGVSRTIVWTANRDEPPIAGGSIIFGHGGALQWSRTPSTPGSQLNPISDS
STPAASAAMLNTGNFVLYDMNRQVIWSTFSFPTDTLLAGQNLRPGRFLLSSVSQSNHASG
KYRLENQQDGNLVMYPVGTIDSGSAYWSTWTFNMGLLLTLSLDPNGTISMFDRKNSYTKI
LFHANQPSNASPDMEIYYHLTFDPDGILRLYSHVFFKLGRAPTTEVEWLEPGSDRCLVKG
VCGPNSFCHLTVTGETSCSCLPGFEFLSTNQSTLGCWRALPTGGCVRNSSNDETRMTTTM
VEVKNTTWLENPYAVLPATTSIEACKLLCLSDCACDIAMFSDSYCSKQMLPIRYGRMPGN
TTLFVKIYTYQTISGTRQRAMSIHANSALISGVSLAIFSLLVLLVASLLPICRHRRSLAH
MTMTAPRQEDSRIDGSIVGLRSYSFQELDVATNGFGEELGKGAYGTVFKGVVADTNQDIA
VKRLEKMAEDGQREFNREVRVIARTHHRNLLRLLGFCNEGIHRLLVYEYMPNGSLANLLF
HSDASPAWSKRVAIALDVARGLQYLHSEIEGPIIHCDIKPENILIDSLGIAKIADFGLAK
LLIGNQTKTFTGIRGTRGYLAPEWSKNRAITVKADVYSYGIMLLEVISCKKSMDLKRAGE
EYNISEWAYECVMFGDAGKVADGVDEAELVRMVNIGIWCTQSEPVMRPAMKSVALMIEGA
IEKNDEVCLKRCKVQQGSSVYQPVQIHELASWNTLKIDNQVFYIMQL
Download sequence
Identical sequences A0A0E0D913
OMERI03G35980.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]