SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G00130.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G00130.1
Domain Number 1 Region: 499-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-75
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 68-165,197-226
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-25
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 
Domain Number 3 Region: 883-1026
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.86e-24
Family Protein kinases, catalytic subunit 0.0072
Further Details:      
 
Weak hits

Sequence:  OMERI04G00130.1
Domain Number - Region: 379-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000981
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI04G00130.1
Sequence length 1040
Comment pep:novel chromosome:ALNW00000000:4:197971:205554:-1 gene:OMERI04G00130 transcript:OMERI04G00130.1 description:""
Sequence
MPSLYIFLGLLLFSLQAPPCPATTDTLKAGQVLSAGDKLVSRNGKFALGFFNPSANISKS
SDNISSSWYIGIWFNKIPVFTVVWVANRERSIAEPELKLTQLKISQDGNLAIVNSANESI
IWSTRIVNRTEASMNTSVLLHDSGNLVIESTSNAVLWQSFDYPTDVALPNAKIGWNKVTG
LNRVGVSKKSLIDMGPGSYSVQLYTNGTRRVTLEHRNPSIEYWYWSPDESGMKIPALKQL
LYMNPQTRGLVTPAYVNSSEEEYYSYNSSDESSSTFLLLDINGQIKFNVWSQDKQSWQSL
YTQPVDPCRSYDTCGPFTICNGNSQPFCDCMENFTRKSPRDWDLGDRTGGCSRNTPLDCT
RNTSSTDIFHPLIHVTLPRNPQTIQEATTQSECAQACLSSCSCTAYSYQNTSTCSIWHDE
LFSVNQDDGIEIHSQDVLYLRLAAKDLQSLRNNKRKPNVAVVIAASVIGFVLLMVGMFLL
IWRNRFDWCGAPLHDGEDSSGIKAFRYNDLVHATKNFSEKLGEGGFGSVFKGMFIDLTTI
AVKRLDGDRQGEKQFRAEVSSIGLIQHINLVKLIGFCCEGRKRLLVYEHILNGSLDAHLF
QSNAGTLNWSIRYNIALGVARGLAYLHQSCHECIIHCDIKPQNILLDASFAPKIADFGMA
AFVGRDFSRILTTFRGTVGYLAPEWISGVAVTPKVDVYSFGMVLLEIISGRRNSPNEYTS
DNYHVSYFPVQAINKLHEGDVRNLVDPQLCDDFSLEEAERVCKVACWCIQDDEHDRPAMS
KVVRVLEGMQELEMPPMPRLLAALTKCSDKKLPAILVSMRPQSYAFLGLVLLLFSLLPLA
PCSAANLNNDTLLAGQALAIGDKLISNNGKFTLGFFQPDAGSNFGMAVFVGRDFSRVLTT
FRGTVGYLAPEWISGVAITPKVDVYSYGMVLLEIISGMRSLPNVHSSNGHHAAYFPVQAI
SKLHEGDVQSLVDPRLSGDFNLEEAERVCKVACWCIQDNEFDRPTMGEVVLVLEGLQEFD
MPPMPRLLEAITRSSNVAEM
Download sequence
Identical sequences OMERI04G00130.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]