SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G05380.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G05380.1
Domain Number 1 Region: 143-430
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-80
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 2-52
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000419
Family alpha-D-mannose-specific plant lectins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G05380.1
Sequence length 472
Comment pep:novel chromosome:ALNW00000000:4:10137636:10139635:-1 gene:OMERI04G05380 transcript:OMERI04G05380.1 description:""
Sequence
MEITENGNLVLFDQRNGTVWQSFDHPTDALVPGQSLLQGMMLKANTSPTNWTGSKIYITI
LQDGVYGYVESTPPQLYYNYIVSTNKSKRVPTTVTFTNGCLSIFVESTQPGNPDGRIALP
EAKSTQYIRRKYRERDEELDFDIMPGMPMRFSFQKLRKSTQDFSKKLGEGRFGSVYEGKI
SEEKVAVKRLESARQGKKEFLAEVETIGSIEHINLVRLIGFCVEKSNRLLVYEYMSRGSL
DRWIYYHHNNAPLDWNTRCRIILDIAKGLCYLHEECRRKIAHLDIKPQNILLDDNFNAKL
ADFGLSKLIDRDQSKVMTVMRGTPGYLAPEWLTSQITEKVDVYSFGVVLMEIISGRKNIH
ISQPEEAVQLINLLREKAQNNQLIDMIDKHSNDMVSHQEEVIQMMKLAMWCLQNDSDRRP
SMSMVVKVLEGAMRVENCLDYSFFNANSVISVQGIPSTYSAPPRASILSSPR
Download sequence
Identical sequences A0A0E0DC61
OMERI04G05380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]