SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G05430.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G05430.1
Domain Number 1 Region: 1224-1511
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-77
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 422-661
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.43e-55
Family Protein kinases, catalytic subunit 0.0007
Further Details:      
 
Domain Number 3 Region: 805-898,994-1011
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-25
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 4 Region: 112-187,283-308
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-21
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 
Weak hits

Sequence:  OMERI04G05430.1
Domain Number - Region: 1101-1143
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00184
Family Hairpin loop containing domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G05430.1
Sequence length 1553
Comment pep:novel chromosome:ALNW00000000:4:10166030:10177233:-1 gene:OMERI04G05430 transcript:OMERI04G05430.1 description:""
Sequence
MCPANPFVYFMVLVFVVLAVAAPSVCGQRSDYPTANLSTLWVNNKVILPHSISYTDGSSV
RTIVLRSPQNLYGPSFAAGFFCTPPCQAFLFTVFIVYTNSGAGITLPVNGMAQVIWSANR
ANPVGENATLELTGDGNLVLREANGKLVWSSSTSGRSMAWRSLSRVLLVLFDQKNKTVWQ
SFDHPTDALVPGQSLLQGMRLRANTSTTNWTESKLYMTVLSDGLYGYVESTPPQLYYEST
VSTNRSGKDLTRITFTNGSLSIFAQSIQAGEPDGSIALPKAKSTQYIRLESDGHLRLYEW
SDAEVKWTMVSDVIKIFPDDCAFPTVCGEYGICTGGQCMCPAQSNSSPSYFQPVDKRKAN
LGCAPVQIIPSSAPTQNKSYKTNEILGSTLAAIITLVLVVIIASYVRRRKYQELDKELDF
DILPGMPVRFSFEKLRQCTEDFSKKLGEGGFGSVFEGKIDEERVAVKRLEGARQGKKEFL
AEVETIGSIEHINLVRLIGFCAEKSHRLLKIAHLDIKPQNILLDENFNAKLADFGLSKLI
DRDQSNVMTVMRGTPGYLAPEWLTSPITEKVDIYSFGVVLMEIISGRKNIDISQPEESVQ
LLNLLREKAQNNRLIDMIDKHSNDMVSHEEEVIQMMKLTIWCLQNDSSRRPSMSMVVKVL
EGAMSVENCIDYGFFNASSVISVQDNPSSYSAPPPASIFPLCNSSTMRPANPFCFDVTVA
VVAAVVLATAAPSSVSGQRSDYPTANLSTRWVNNAAVLPHSVTYSDGSAVRAIVLRSPKA
FYGPSFAAGFFCTPPCQAFLFAVFIVYTNSGAGITSVVNGVAQVIWSANRASPVGENATL
ELTGEGDLVLREANGRLVWSSGTSGRSVAGMEITENGSLVLFDQRNGTVWQSFDHPTDAL
VPGQSLKQGMRLTANTSTTNWTESKLYMTVLPDGLYGYVESAPPQLYYKPQVRTNKSGQN
LTRVTFTNGSLSIFVPSTQPGNTDNSIALPSAKSTQYIRLESDGHLRLYEWSDAESKWTM
VSDVIKIFPDDCAFPTVCGEYGICTSGGGQCICPVENNSSTSYFHPVDERKANLGCAPVT
PISCQEMKNHKFLTLTDVSYFDESQIIMNAKNKDDCKQACLKNCSCRAVAFRYGQNDSDG
QCQSVTEVFSLQSIQPETVHYNSSAYLKVQITPSASDPTQNKTKTILAATLAAITTLVLV
VIVAIYVRRRRKYQELDEELDFDIFPGMPTRFSFEKLRECTDDFSKKLGEGGFGSVFEGK
IGEESVAVKCLEGARQGKKEFLAEVETIGSIEHINLVRLIGFCAEKSNRLLVYEYMPRGS
LDRWIYYRHNNTPLDWCTRCKIIMDIAKGLCYLHEECRRKIAHLDIKPQNILLDENFNAK
LADFGLSKLIDRDQSKVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVLMEIISGRKNI
DISQPEESVQLINLLREKAQNDQLIDMIDKHSNDMVSHQEEVIQMMKLAMWCLQNDSSRR
PSMSMVVKVLEGAMSVENCLDYSFFNANSVISAQGNPSTYSAPPQASILSGPR
Download sequence
Identical sequences OMERI04G05430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]