SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G05470.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G05470.1
Domain Number 1 Region: 512-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-76
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 116-193,289-307
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-26
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G05470.1
Sequence length 842
Comment pep:novel chromosome:ALNW00000000:4:10202280:10206135:-1 gene:OMERI04G05470 transcript:OMERI04G05470.1 description:""
Sequence
MDEKSTRQHKGNLLDIDIDTQNLQCQHRPSPGSALTIPRPTSRRGGSTTPRCSRTVSPYT
DGSAVRAIILRSTQTLYGPSFAAGFFCAPPCQAFLFAIFIANFNSGYGIPLEENNMARVI
WSTNRASPLGENATLELTGDGDLVLREIDGRLVWSSNTSGQSVAGMQITEHGNLVLFDQR
NATVWQSFDHPTDVLVPGQSLLQGMKLRANTSTTNWTESKLYMTALSNGLYGYVGSKPPQ
LCYKYEVGTGQKGKDPTRVTFTNGSLSIFLQSTQAGKPDKRIALPEDKSTQYIRLEYDGH
LRLYEWSGFEWTMVSVVIDMDNCDFPTVCGEYAICTGGQCICPLQTNSSSSYFQPVDERK
ANLGCAPVTPISCQEMKNHQFLTLTDVYYFDGSIITNAKSRDDCKQASLKNCSCRAVLFR
YYHNDSDGECKSMTEVFSLQLIQPEILHYNSSVYLKVQLPPSASAPKQKRIKVILGATLA
AISSFVLVIIVGIYVRRRRKYQELDEELDFDILPGMPMRFSFEKLRECTEDFSKKLGEGG
FGSVFEGKIGEKRVAAKRLEGARQGKKEFLAEVETIGSIEHINLVKVIGFCAEKSNRLLV
YEYMPRGSLDRWIYYRHNNAPLDWCTRCRIILDIAKGLCYLHEECRRKIAHLDIKPQNIL
LDEKFNAKLADFGLSKLIDRDQSTVVTVMRGTPGYLAPEWLTSQITEKVDIYSFGVVFLE
IISGRKNIDISEPEESVQLVNLFREKAQNNQLRDIIDKHSDDMISHHQEEVIEMMKLAMW
CLQNDSSRRPSMSMVVKVLEGAMSVEDCLDYSFTNAKSVISAQDNPSTCLDPPSASILSG
PR
Download sequence
Identical sequences A0A0E0DC78
OMERI04G05470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]