SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G07140.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G07140.1
Domain Number 1 Region: 505-791
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.81e-76
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 71-170,202-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-28
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  OMERI04G07140.1
Domain Number - Region: 384-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000569
Family Pan module (APPLE domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G07140.1
Sequence length 817
Comment pep:novel chromosome:ALNW00000000:4:12852274:12854727:-1 gene:OMERI04G07140 transcript:OMERI04G07140.1 description:""
Sequence
MLSVHVFIGLLLLSLHAPPYSAAVDDTLAAGQVLAVGEKLVSRNGKFALGFFQPSAIAIS
KSSNYTNALGWYLAIWFNKIPVFTTVWVANRERPITVPRLNSTRLKMSGDGNLYILDHAT
NSIIWSTDHVVNTTTETGMNTSATLLNSGNLVIRNPSGVVSWQSFDNPTDVVHPGAKFGW
NKATGLNRLGISKKSLIDPGLGSYSVELDTTGARGLILKHRNPSMEYWSSDRALIIPVLK
SLFEMDPRTRGLITPAYVDNSEEEYYIYTMSDESSSVFVSLDVNGQIKMYVWSRANQSWQ
SIYAQPVDPCTPSATCGPFTICNGNSTQTCDCMESFSVKSLWDWELDDRTGGCIRDTPLH
CVSDKNMTSSTDMFQPIGLVTLPYDPQIMQDATTQGECAQACLSDCSCTAYCYQNSRCSV
WHGKLLNVNKNDGIYINADNVLHLRLAATDFQDLSKNKRKTNVALVVGANIVSFVLALIM
ILLMIRGNKFKCCGAPFHDNEGRGGIIAFRYTDLAHATKNFSDKLGEGGFGSVFKGVLTD
MTTIAVKKLDGARQGEKQFRAEVSSIGIIQHINLVKLIGYCCEGDKRLLVYEHMLNGSLD
VHLFQSHAAVLNWITRHQIAIGVARGLSYLHESCRECIIHCDIKPENILLDISYFPKLAD
FGMATFVGRDFSRVLTTFRGTVGYLAPEWISGVAITPKVDVYSFGMVLFEIISGRRNSPE
VHTSGNYDATYFPVRAINKLHEGDMSSLVDPRLHGDYNLDEVVRVCKVACWCIQDDEFDR
PTMREVVRVLEGLQELDMPPMPRLLATLTNFSAVASM
Download sequence
Identical sequences A0A0E0DCW6
OMERI04G07140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]