SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G10070.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G10070.1
Domain Number 1 Region: 474-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-77
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 49-149,181-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.37e-26
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  OMERI04G10070.1
Domain Number - Region: 350-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0018
Family Pan module (APPLE domain) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI04G10070.1
Sequence length 785
Comment pep:novel chromosome:ALNW00000000:4:16664741:16667098:1 gene:OMERI04G10070 transcript:OMERI04G10070.1 description:""
Sequence
MPCRHAATLDALSPGQELTGGDKLVSSNGRFALGFFQTDSNKSSNSTPNIYLGIWFNTVP
KFTPVWVANGENPVADLASCKLLVSSDGNLAVVGTTQAKNSSMVWSSKANIPTNTTLVLL
DDGNLVLRSTSTTNASSTILWQSFDHPTDTVLQGGKIGWNNATGVNRRLVSRKNTADQAP
GMYSFELLGHNGPTSMVSTFNSSNPYWSSGDWNGRYFSNIPETVGQTWLSLNFTSNEQEK
YIEYAIADPTVLSRTILDVSGQLKALVWFEGSRDWQTIFTAPKSQCDVYAFCGPFTVCND
ITFPSCTCMKGFSVQSPEDWELDDRTGGCVRNTPLLCNSNKTAAGTADKFYPMTSVQLPD
KAQSIGVATSADECAAACLSSCSCTAYSYGEGGCSVWHDKLLNVRQQGNGVLYLRLSAKE
VLESRRNNRWGVILGASIGASTAALGLIFLLMIWIRKGKRYNLTMDNVQGGMGIIAFRYV
DLQHATKNFSEKLGAGSFGSVFKGSLSDSTIIAVKRLDGARQGEKQFRAEVSSIGIIQHV
NLVKLIGFCCEGDRRLLVYEHMPNRSLDAHLFPSSGAVLSWNIRYQIALGVARGLAYLHS
SCRDCIIHCDIKPENILLDSSFTPKVADFGMAKFLGRDFSHVVTTMRGTIGYLAPEWISG
TAITSKVDVYSYGMVLLEIISGSRNSSKQSSRDGVHEACFPVQVARNLLNRDIDSLVDEN
LHGEVNLEQVERVCKVACWCIQDDEFDRPTMSEVLQFLEGISEVETPPMPRLLHTIAGGL
DSKIM
Download sequence
Identical sequences A0A0E0DE54
OMERI04G10070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]