SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G10110.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G10110.1
Domain Number 1 Region: 488-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.86e-75
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 62-157,189-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.42e-29
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  OMERI04G10110.1
Domain Number - Region: 366-408
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.011
Family Pan module (APPLE domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI04G10110.1
Sequence length 798
Comment pep:novel chromosome:ALNW00000000:4:16728568:16730964:1 gene:OMERI04G10110 transcript:OMERI04G10110.1 description:""
Sequence
MALPITVLFLLFTLHIPASCKVTDTISAGETLAGNDRVVSSNSKFALGFFPTSSKSSHNA
SNWYLGIWFNQVPKLTPAWVANGDKPATGPTSPEATISGDGNLVILDQATKSIIWSTQAD
ITANTTMVKLLDNGNLVLQNTSNSSVVLWQSFDYPTNTHLAGAKLGRNKVTGLNRRLVSR
KNSVDPASGMYSYELTDNNGSARFILAALNSSIPYWSSGEWNGHYFGSIPEMTGQRLIDF
TFVNNDEEVYFTYTLLDSATIMRFMLDISGQTKIFLWVEHVQDWVPTYTNPKQCDVYGIC
GAFTVCEESKLPICKCMKGFSVRSPNDWELDDRTGGCVRNTPLDCGINRNTSMQDRFHPM
PCVGLPSNGQIIEHVTSAGGCAKVCLSNCTCTAYYYGNTGCSVWNDELINVKQLQCGDIA
NTDGATLYLRLAAKEVQSIKSSGRSIIIGVAVTASVASFALALFLIAKIPRNKSWLLGHR
RKNFHSGSGVIAFRYADLQHATKNFSDKLGAGGFGSVFKGLLNESTVIAVKRLDGARQGE
KQFRAEVGSIGIIQHINIVKLIGFCCESDRRLLVYEHMPNLSLDTHLFHSDATILNWSIR
YQIALGVARGLAYLHDSCQDCIIHCDIKPENILLDASFVPKIADFGMAKFLGREFTQVLT
TMRGTIGYLAPEWISGTVITSKVDVYSYGMVLLEIISGTRNSSKEFATRDDYEYFPLLVA
HKLLDGNAGSLVDQNLHGDVDLEQVERAFRVACWCIQDNELDRPTMSEVVQYLEGLLEVG
IPPVPRLLQAIAGNPYSK
Download sequence
Identical sequences OMERI04G10110.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]