SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G10140.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G10140.1
Domain Number 1 Region: 487-774
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-76
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 67-161,193-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-29
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  OMERI04G10140.1
Domain Number - Region: 354-409
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0049
Family Pan module (APPLE domain) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI04G10140.1
Sequence length 806
Comment pep:novel chromosome:ALNW00000000:4:16740169:16742589:-1 gene:OMERI04G10140 transcript:OMERI04G10140.1 description:""
Sequence
MLLPCHVLLGLLLLLSLHTPASYAAATDTVSPGHSLAGSDRLVSNNSKFALGFFKPGNES
SYTNHNSYLGIWFNKVSKLTPLWTANGENPVVDPTSPELTISGDGNLAILDHATKSIIWS
TRANITTNDTIAVLLNNGNLVLRSSSNSSNIFWQSFDYPTDTLFAGAKIGWDKVTGLNRR
LVSRKSSVDQAPGIFSLELGLNGEGHLLWNSTVAYWSSGDWNGRYFGLAPEMIGDVMPNF
TFVHNDQEVYFTYTLYDDTAIVHTGLDVFGIGFVGMWLEGNQEWFKNYRQPVVHCDVYAV
CGPFTICDDNKDLFCDCMKGFSVRSPKDWELDGQTGGCIRNTPLSCGSSKDRTSLTDKFY
PMQSIRLPHNAENVQAATSGDECSQVCLSNCSCTAYSYGKDGCSIWHDELYNVKQLSDAS
SDRNGGVLYIRLAAKELPSSERKKNGNISGIAIGASTATLFLMILLLILWRRKGKWFAHT
LQKPESGIGVIAFRYINLQRATKAFSEKLGGGSFGSVFKGYLSNSTIAVKRLDGAYQGEK
QFRAEVNSIGIIQHINLVKLIGFCCEGDNRLLVYEYMPNRSLDVCLFEANDIVLDWTTRY
QVAIGVARGLAYLHNSCRDCIIHCDIKPENILLDASYVPKIADFGMAKILGREFSRAMTT
MRGTIGYMAPEWISGTVVTSKVDVYSYGMVLFEIISGRRNSSHECFRDGDYSSFFPMQVA
RKLLNGDIGSLVDASLKGDMNLVEVERACKIACWCIQDNEFDRPTMAEVVQALEGLLELD
MPPLPRLLSAITGGSHSMTPQYFDSV
Download sequence
Identical sequences A0A0E0DE64
OMERI04G10140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]