SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G10150.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G10150.1
Domain Number 1 Region: 411-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-76
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 65-158,190-206
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-28
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  OMERI04G10150.1
Domain Number - Region: 277-333
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0053
Family Pan module (APPLE domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI04G10150.1
Sequence length 730
Comment pep:novel chromosome:ALNW00000000:4:16748756:16751184:1 gene:OMERI04G10150 transcript:OMERI04G10150.1 description:""
Sequence
MPLLRHVLLGIVLLFLHTLASSAAKDTVSPSQALAGSNRLVSNNSKFALGFLKPGNESYN
NHNSFLGIWFNKVPKLTLLWTANGDNPVVDPTSPELTISGDGNLAILDHATKSIIWSTRA
NITTNDTIAVLLNNGNLVLRSSSNSSKIFWQSFDYPTDTLFAGAKIGWDKVTGLNRRIVS
RKNSIDQAPGMYSLEVGLNGDGHLLWNSTPIVHCDVFAICGPFTICDDKKDPNNNPFCDC
MKGFSVKSPKDWELDDRTGGCMRNTPLSCGSSKDRTDLTDRFYPMQSIRLPHNAENVQAA
TSGDQCSQVCLSNCSCTAYSYGEDGCSIWHDELYNVKQLLDAASDGNGVVLYVRLAAKEL
QNSERKKSGILIGVAIGASTGTLFLIILLLILWRIKGKWIIAHPLEKSEDSIGIIAFRHI
DLRRATKNFSEKLGGGSFGSVFKGNLNDSTIAVKRLDGAHQGEKQFRAEVNSIGIIQHIN
LVKLVGFCCEGDNRLLVYEYMPNCSLDVCLFKANDIVLDWTTRYQIAIGVARGLAYLHTS
CRDCIIHCDIKPENILLDASYVPKIADFGMAKILGREFSRAMTTMRGTIGYLAPEWISGT
VVTSKVDVYSYGMVLFEIISGRRNSSHENFRDGDFSFFFPMQVARKLLDGDVGSLVDASL
KGDVNLVEVERACKIACWCIQDNEFDRPTMGEVVQSLEGLLELDMPPLPRLLNAITGGSH
PVTPQYFDSL
Download sequence
Identical sequences OMERI04G10150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]