SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G14400.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G14400.1
Domain Number 1 Region: 476-761
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-77
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 78-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-23
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 
Weak hits

Sequence:  OMERI04G14400.1
Domain Number - Region: 365-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI04G14400.1
Sequence length 769
Comment pep:novel chromosome:ALNW00000000:4:20497219:20501330:1 gene:OMERI04G14400 transcript:OMERI04G14400.1 description:""
Sequence
MALLFVPFLFSLLITTSPSAAMDTVTAGRPLAGGDKLVSGNGKFALGFFQMAGGNGSSST
APKWYLGVWFNTVSKFTPAWVANRENPLADGGASWQLAISGDGNLVISNRANNSMTSWSS
QANTTTSNTVAVLLNSGNLVLSDASNTSIIFWESFSHMTDTFLPGAKMGWNKATGFTHGL
VSSKNSGDLSPGVYSATPSSDFANPGLFLAWNSSVVYWSTGPWNGDHFSNTPELTARALF
TFDFVSNDHEEYFTYRLRNDTMVTRYVLDASGQAKNMIWSSVSEDWVTFYAKPGAQCDVY
AVCGAFAVCREDMLPFCNCMKGFSIRSPQDWELGDQTGGCVRNIPLNCGVTDRFYAMSYV
RFPANAKNMEAGTADGCKQACLNDCSCTAYSYNGSCNVWSDGLFNVARQYNYNQSSSGGI
LYLRLAAEDDVSESSKHTRGLIIGVVAVASVLTLSLFTIVIMFVRRNKRNCSSVRHGRII
CGTVAFRYKDLQHATKNFSERLGGGSFGSVFKGVLTDSTVIAVKRLDGARQGEKEFRAEV
RSIGIIQHINLVRLIGFCCEGSNRLLVYEYMPNGSLDSNLFGSKVASLDWSTRYKIALGV
ARGLAYMHGNCLDCIIHCDIKPQNILLDASFVPKIADFGMSKLMGRDFSQVLTTVRGTIG
YLAPEWVSGMAISSKVDVYSYGMALLEIVFGRRNFRGECTSNATYFPVQVVGKLLQGNVQ
CLLDQNIQSDINSEEVERACRVACWCIQDDESNRPTMAQLQAACAPFFR
Download sequence
Identical sequences OMERI04G14400.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]