SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G21380.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G21380.1
Domain Number 1 Region: 2371-2683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-83
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 48-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.93e-47
Family Protein kinases, catalytic subunit 0.0016
Further Details:      
 
Domain Number 3 Region: 1066-1308
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.39e-45
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 4 Region: 1693-1900
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-43
Family Protein kinases, catalytic subunit 0.0028
Further Details:      
 
Domain Number 5 Region: 1955-2048,2080-2110
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-29
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Domain Number 6 Region: 396-504
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.95e-26
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Domain Number 7 Region: 672-783
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-23
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Domain Number 8 Region: 1357-1411
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000432
Family alpha-D-mannose-specific plant lectins 0.019
Further Details:      
 
Weak hits

Sequence:  OMERI04G21380.1
Domain Number - Region: 1542-1606
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000216
Family Anti-platelet protein 0.068
Further Details:      
 
Domain Number - Region: 937-979
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Anti-platelet protein 0.012
Further Details:      
 
Domain Number - Region: 2233-2276
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0149
Family Anti-platelet protein 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI04G21380.1
Sequence length 2701
Comment pep:novel chromosome:ALNW00000000:4:26654716:26680931:-1 gene:OMERI04G21380 transcript:OMERI04G21380.1 description:""
Sequence
MARNNLGDNLYLRLADSPGEKRNNENQNRAMLGNFRASHEVYEKNQEFPCINFEDVVTAT
NNFSDSNMLGEGGFGKVYKGKLEGGKEVAVKRLSTGSTQGVEHFTNEVVLIAKLQHKNLV
RLIGCCIHGDEKLLIYEYLPNKSLDHFLFDPANKFILDWPTSGYMSPEYAMDGVFSVKSD
IYSFGVILLEIVSGLKISLPQLMDFPNLLAYAWRLWKDDKTMDLMDSSIAESCSKNEVLL
CIHIGLLCVQDNPNSRPLMSSVVFMLENEQAALPAPIQPVYFAHRASETKQTGENTSSSN
NNMSLTVLEGRKKESTVMEAATTNIFYRPVIFLSVLLCFQYRAAGVASDTLSNGRNLTDG
NTLVSAGGSFTLGFFSPGLPTRRYLAIWFSESADAVLWVANRDSPLNDTAGVLVIDGTGG
LLLLDGAAGQAAWSSSNTTGSSSSAAAQLLESGNLVVRDQRSGDTLWQSFDHPSNTLIAG
MRLGRNPRTGAEWSLTSWRAPDDPATGGLPPRDGHERASGLRLVYRTGPWNGLWFSGVPE
MASYSSMFANQGVCGLGEPYREPGEKKPRVKEPPADTSVLPSVRLRPLLRVSDATPAADV
PRERRTMKKKKKVRLSQPSDRLTPAKPLIFPGDDKLISDGGVFALGFFSLTNSTPSLLYL
GIWYNNIPERTYVWIANRDNPITTPSAKLAVTNTSDLVLSDSKGLALWSTSINGTIRGSS
VGERATAELRNTGNFVVRLPNGTEAWQSFEHPTDTILPGFKLWVNYKKHVAVQVVAWKGP
QDPSTGDFSLSGDPSQWGIQLVVWHGSIPSYRTEVWTGAPVYDKDISTQVIDNGEEIYET
YSAADGLLTHWKVDYTGNVFFRRWDNQSSSWEMSAERPGHGCLQYGACGPFGYCDVTGSF
QECKCFDGFELADGLSANFSKGCRRKEALKCSGGEDHFLTLPGMKVPDKFLYIRNISFEE
CTDKCNRNCSCTAYAYANWKTDITMGDISRCLVWTGELLDSGKGAPANGENLYLRLSGSR
AVNKKNIVKTVLPAIACMLILTAGMRLRQNKELLNNTGLESWDQNLEFLNISFEDITSAT
NGFHDTNMLGKGGFGKVYKGTLEDGMEIAVKRLEKDSAQGVEHFRNEVVLIAKLQHKNLV
RLLGCCIRGDEKLLIYEYLPNKSLDKFLFDHAMKSVLDWPTSGYMAPEYAMEGIFSVKSD
TYSFGVLILEIVSGLKISSPHHIVMDFPNLIAYAWNLWKDGMAEAFVDKMVLESCLLNEV
LQCIHIGLLCVQDSPNARPHMSLVVSMLDNEDMARPIPKQPIYFVQRHYDEEERQGSESD
DQLTQANRLISPGDVLISKGRVFALGFFSPTASNQSFFLGIWYHNISESERTYVWVANRD
NPITTPSSSSSFATLVISNSSNLVFLWNGTRPYVRFIGPNNMWSSVFPYSSSLIYETSVS
TDDEFYVIYTTSDGSPYKRLQLDYTGTLKFLAWNGSSSSWTVVFQRPAPAVECDPYASCG
PFGYCDATAAIPRCQCLDGFEPDGSNSSSRGCRRKQQLRCGDRDDRFVTMAGMKIPDKFL
HVRNRSFDECAAECSRNCSCTAYAYANLTGADQARCLIWSGELADTGRANIGENLYLRLA
DSTVNMKKSDILKIVLPVITSLLILMCICLAWICKSRGIHRSKEIQKKHRLQHLKDSSEL
ENDNLELPFICLEDVVTATNNFSDHNMLGKGGFGKVYKGVLEDGKEVAIKRLSKGSQQGV
EEFRNEVVLIAKLQHRNLVRLISYCIHEDEKLLIYEYLPNKSLDTFLFDATRKSVLDWTT
RGYMSTEYALEGSFSVKSDTYSFGVLLLELACSLWKDGNAMDLVDSSIRESCLLHEVLRC
IQIALSCVQDDPTARPLMSSIVFMLENETASLPTPKEPAYFTARLYGTKDTRENKERSVN
NLTPAKPLYPGDMLISDGGAFALGFFSPTKSNATLYVGIWYHKIPNRTVVWVANRDNPIT
APSSAMLFISNSSDLVLSESGGHTLWEARNNITTGGSGATVVLLNSGNLVLRSPNRTILW
QSFDHLTDTILPGMKLLLKYNGQVAQRIVSWKGPDDPSTGNFSLSGDPNSDFQVLVWNGT
SPYWRSGAWNGALVSAMYQSNTSSVTYQTIINKGNEIYMMYSVSDDSPSMRLMLDYTGTI
KMLIWNSNLFAWSVLFSNPSYTCERYASCGPFGYCDAAEAFPTCKCLDGFKPDGLNISRG
CVRKEQMKCSYGDSFLTLPGMKMPDKFLYIRNRSLDECMEECRHNCSCTAYAYANLSSAS
MMGDTSRCLVWMGELVDLAKVSGGGENLYLRLPSPTAVKKETDVVKIVLPVVASLLILTC
ICLRSKEIQNKIMVQYLSASNELGAEDVDFPFIGFEYVVTATNNFSSYNMLGKGGFGKVY
KGILEGGKEVAVKRLSKGSGQGIEEFRNEVVLIARLQHRNLVKLVGCCIHEDEKLLIYEY
LPNKSLDAFLFDATRKTVLDWPNRFKIIKGVARGLLYLHQDSRLTIIHRDLKAGNILLDA
EMSPKISDFGMARIFGGNQQQANTTRVVGTYGYMSPEYAMEGVFSVKSDIYSFGILLLEI
ISGFRISSPHLIMGFPNLIAYSWSLWKDGNARDLVDSSVVESCPLHEVLRCIHIALLCIQ
DHPDDRPLMSSVVFMLENNTAPLPQPKQPIFFVHKKRATEYARENMENSVNGVSITALEG
R
Download sequence
Identical sequences OMERI04G21380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]