SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G21460.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G21460.1
Domain Number 1 Region: 445-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-78
Family Protein kinases, catalytic subunit 0.0000455
Further Details:      
 
Domain Number 2 Region: 70-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-30
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  OMERI04G21460.1
Domain Number - Region: 344-422
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00863
Family Anti-platelet protein 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G21460.1
Sequence length 763
Comment pep:novel chromosome:ALNW00000000:4:26706080:26710018:-1 gene:OMERI04G21460 transcript:OMERI04G21460.1 description:""
Sequence
MLLLSNSGRTTTGAELGDTLGKGRNITDGERLVSAGGSFTLGFFSPASSSSSSTSRRYLG
IWFSVSDDVVCWVANRDRPLTDTSGVLVITDAGSLLLLDGSGHVVWSSNTTTGGGASMAA
QLLESGNLVVSDRGNGSAGAVVVWQSFDHPCDTLLPGMKIGKNLWTGAEWYLSSWRSSGD
PSPGNYRYRTDTKGVPENVLWDGDGEVYRTGPWNGLWFSGIPEMGTYSDMFSYQLTVSPG
EITFGYSANAGAPFSRLVVTGVGEVQRLVWEPSSRAWKNFFQGPRDLCDDYGKCGAFGLC
DAGAASTSFCSCVEGFTPTSPSPWKKMRDTSAGCRRDAALGCATDGFLAVRGVKLPDAHN
ATVDKRVTVEECRARCLANCSCVAYAPADIEGGGGGGAGSGCIIWADDLVDLRYVDGGQD
LYAKMVFGNGGLQLLWLLVHPLLQLLGVKEATGNFSESNIIGRGGFGIVYQGKLPSGRKV
AVKRLTQSLVTDKRKEDFIREVEMMSNTRHAYLVELLCYCQEGGEMILVYEYMENMSLDL
YIFGEDRRLRASLNWVQRLDIIRGIAIGVEYLHNVKVIHRDLKPSNILLDDNWRPKVADF
GTAKLFINDQTDPTLVLSAGYIAPEYAAQGNLTLKCDVYSFGVVLLEIISGKRNRTLPTF
LRDTWESWKQHEIEDILDLGLIKPEPDLLLGLDRCIQIGLLCVQQSPDDRPTMNQVVSML
TKYSSQIAMPKNPMINSRCEPSVSQVVSDTEPASHDRPGPSLN
Download sequence
Identical sequences OMERI04G21460.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]