SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G21470.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G21470.1
Domain Number 1 Region: 481-664
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-27
Family Protein kinases, catalytic subunit 0.0043
Further Details:      
 
Domain Number 2 Region: 81-193
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-24
Family alpha-D-mannose-specific plant lectins 0.0028
Further Details:      
 
Weak hits

Sequence:  OMERI04G21470.1
Domain Number - Region: 372-433
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00981
Family Pan module (APPLE domain) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI04G21470.1
Sequence length 695
Comment pep:novel chromosome:ALNW00000000:4:26724867:26728386:-1 gene:OMERI04G21470 transcript:OMERI04G21470.1 description:""
Sequence
MRSTRQSPNLLRLVAFFFLLSGQTSAAAVGVADKLDKGQNLTDGQSLVSSGGGSYTLGFF
SPGKSTKRYLGIWFTVSGDTVYWVANRDRPLDDKSGVLLLNDDGSQLVLLDGGSRRTVWS
ASFLGAASAAVVQLLDSGNLVVRNGRGSGGDAAYLWQSFDQPSDTLLPGMKMGKSLWSGQ
EWFITAWRSADDPSPGDYRRTLATDGLPELVLWRGGGGGGGATKVYRTGPWNGRFFNGVP
EASNYSDKFPLQVTSSAREVTYGYGSVATAGGAPLTRVVVNYTGVVERLVWDASSRAWQR
FFQGPRDPCDSYARCGPFGLCDADAAATSFCGCVDGFTAASPSAWALWNTSGGCRRDVAL
DCAAGGGGSRTTDKFKVVRGVKLPDTHNASVDMGATAAECERRCLGNCSCVAYAAADING
GGCVIWTDDIVDLRYVDRGQDLYLRLAKAEFAETKRSLMILVVPPVAATIAILLIAFVGV
QSDGRMVAVKRLKQSALTNKGKKDFAREVAVMAGLHHGSLLRLLAYCNEGNERILVYAYM
NNRSLDNHIFGYASPEYALRGEMTLKCDVYSFGVVLLETLSGVRNGSMQTLLPQAWRLWE
QGNHMDLLDPAMARPASDDAELLYDLERCIHIGLLCVQDMADDRPTMSEIVAMLTSSVGI
NEWALAHSKINSLENHKIPPHGMACMWSLVPPCLF
Download sequence
Identical sequences OMERI04G21470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]