SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI04G25580.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI04G25580.1
Domain Number 1 Region: 58-239
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.0000000000000616
Family Plant cytotoxins 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI04G25580.1
Sequence length 249
Comment pep:novel chromosome:ALNW00000000:4:30068870:30073246:1 gene:OMERI04G25580 transcript:OMERI04G25580.1 description:""
Sequence
MASSSSSRRSSSSSKRTKHQMLWPRKQADEIAFRVASSKVLERRQSAPQHIPRYSLPVTA
TDEEFNRLMEQRHNRMTEIASITIDGVPVTHPLQKDPKSFTYHIVELKDPAEGNSVEILF
LERNLYYVAFRPRFEGDGRDEADPGGWFALSDAEMPGYLRYENVLYDSAYNGNIKETIST
GRQCLQEIRLVLGNHTVQNRLMSKPERQLTHQAVMIMLSETQRFRSVQAHALNNLSNGTS
LVGACFAGY
Download sequence
Identical sequences OMERI04G25580.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]