SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G04250.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G04250.2
Domain Number 1 Region: 492-776
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-73
Family Protein kinases, catalytic subunit 0.00032
Further Details:      
 
Domain Number 2 Region: 68-163,195-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-30
Family alpha-D-mannose-specific plant lectins 0.0024
Further Details:      
 
Domain Number 3 Region: 1305-1354
Classification Level Classification E-value
Superfamily RING/U-box 4.29e-17
Family RING finger domain, C3HC4 0.007
Further Details:      
 
Weak hits

Sequence:  OMERI05G04250.2
Domain Number - Region: 362-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00149
Family Hairpin loop containing domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI05G04250.2
Sequence length 1360
Comment pep:novel chromosome:ALNW00000000:5:3967199:3977587:-1 gene:OMERI05G04250 transcript:OMERI05G04250.2 description:""
Sequence
MLRIFVILVSLLLSIHSPACSAATDTISAGEALLKDQKLVSRNGRFALGFFHPDTDSKFF
PRHALKHWYLGIWFDKIPVLTPIWIANRENPIVGHHKVTKLTIANDGNLVIFNQATRSTV
WSTHASITAKKTMVVLQDNGNLILRDASNSSNVLWQSFDHPTDVMLIGAKFGLDKVTGLN
RVIVSKKSLADPAAGLYCLELDPTGANQYVLEFCNSSIVYWSTGEWNGQFFNSIPEMSGR
TLFDFKFINNNQEKYFVFNLLEKDLITVCFLDISGQMKQLLWLENKQEWATIYTLPKDLC
DIYATCGPFTVCNSNALQVCDCIKGFSVRSPKDWELEDRAGGCIRNTPLDCGTKNQSRTA
TTDKFYSLPGVGLPTEANIIEAARTADQCALACQNNCSCTAYSYGNRCSVWHDDLLNVRQ
YNKGTTSDGEILYLRIAAKDASWSHNKNGKGKIIGAAVASSVVALGLFSTTVIWRYKRKQ
FIAPTNNVQGGNGIVSFKYSVLQHATKNFSEKLGEGGFGAVFKGFLGGSTPIAVKKLGGD
RQGEKAEVSSIGIIQHINLVKLIGFCSENGRRLLVYEHMPNCSLDTHLFHNHTTILNWST
RYQIALGVARGLAYLHESCRDCIIHCDIKPENILLDGSFVPKIADFGMAKFVGRDFSRVL
TTFRGTIGYLAPEWISGVAITSKVDVYSYGMVLFEIMSGRRNSCKQDISDDDHAAYFPVQ
VANELLEGDVRSLLDNKLLDDVNLDEAERISKVACWCVQENESDRPTMGEVVQILEGSKQ
RRSTKPSLRLRARAKKRTKPSSPPPPVERRGGGGGARGEEEEPSTGSAAHEEYNNSQMSR
MDHMDRLNNEPPPFGQKLFMHPRSDPANGAGSSGYVGNTMRSNDLPSSSYAGQAYGQQNR
APIHASYSGHAPAGSSSGSYAPYNTQHMPASNYPHGSEDNFVPSSHVDGRRVALKRRNPI
IHPTDGFSVGNYYAGSSSNTQFSRPMPPNPIPPPESCVRMPSHLGSNHWNDHRYVNHEGS
QRNVRGRHDHSSIHLEQSPAVACPSSSINVPPYHPNANGPFGSTPVQRDRAPLSVHPRIL
PPGPDGSSIAFRERPYYPAPQSTNISAPVPTLPISCDSAPFAHGGYAPRSAHRNNLRTYP
PPAFASSSNPGAVSHEPAIPSYPPAAPSYPPATSAASSSVQPFHAEAAAHLRHPRHVSVG
GSGSARSRRMRDSYHGFHHLMIEDNNLGRSAAERFMMLDQLVIHESREAFDPHWDMRLDI
DDMSYEELLALEERIGHVNTGLADEKISGCVMEVACCSSSHLQDDQDNERCVICLEEYKH
EDTLGRLKCGHGFHCNCIKKWLQVKNTCPVCKAAAADEGS
Download sequence
Identical sequences OMERI05G04250.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]