SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G04410.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G04410.1
Domain Number 1 Region: 70-171,203-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.19e-24
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 
Weak hits

Sequence:  OMERI05G04410.1
Domain Number - Region: 206-277
Classification Level Classification E-value
Superfamily Virus attachment protein globular domain 0.024
Family Adenovirus fiber protein "knob" domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI05G04410.1
Sequence length 324
Comment pep:novel chromosome:ALNW00000000:5:4183413:4184508:-1 gene:OMERI05G04410 transcript:OMERI05G04410.1 description:""
Sequence
MTPQLYIFLGLLLFSLHGTPPCSAAAVNDTLLAGESLAVSDKLVSRNGKFTLGFFQPSVV
SKSGNITSPNWYVGIWFSNISEFTTVWVANRDNPVTDLQLNQTRLELSKDGILVISSNAS
IIWSSATVANTTTATTMNTTTVVLANNGNLMIIGSSSTSNVSWQSFEHPADVMLPGAKFG
WNKVTGATIKYFSKKNLIDPGLGLYYFQLDNTGIVLARSNPAKTYWSWSSQQSSKAISLL
NQLMSINPQTRGRINMTYVYNDEEEYYAYILLDDSLNVYGVLDISGQLIINVWSQDTRSW
QQKIGRLAIEQQGAPETLRWIAVT
Download sequence
Identical sequences OMERI05G04410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]