SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G04420.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G04420.1
Domain Number 1 Region: 496-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-77
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 70-171,203-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.66e-25
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  OMERI05G04420.1
Domain Number - Region: 370-428
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000334
Family Pan module (APPLE domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI05G04420.1
Sequence length 813
Comment pep:novel chromosome:ALNW00000000:5:4190491:4192932:-1 gene:OMERI05G04420 transcript:OMERI05G04420.1 description:""
Sequence
MTPHQLYIILGLLLFSLHGAPPCSAAVNDTLATGESLTVSDKLVSRNGKFTLGFFQPSFV
TNSGDITSPNWYVGIWFSNISAITTVWVANRDNPVTDLQLNQTRLELSNDGNLVISSNAS
IIWSSATVANTTTATTMNNTSVVLANNGNLMIIGSSSTSNVSWQSFDHPADVMLPGAKFG
WNKVTGATIKYVSKKNLIDPGLGLYYFQLDNTGIVLARSNPDKTYWSWSSQQSSKAISLL
NQMMSINPQTRGRINMTYVDNNEEEYYAYILSDESLYVYGVLDISGQLIINVWSQDTRSW
QQVYTQPVSPCTAYATCGPFTICNGLANPVCSCMESFSQKSPQDWEVGNRTAGCFRNTPL
DCGNTTSSTDVFQAIARVQLPSNTPQSVDNATTQSKCAQSCLSYCSCNAYSYENNRCSIW
HGDLLSVNSNDGIDNSSEDVLYLRLSAKDVPSSRKNNRKTIIGVIVAACIVFFLVMLMMI
FLILRKKCLHASQLGGGIVAFRYSDLCHGTKNFSEKLGGGGFGSVFKGVLSDSTIIAVKK
LDGACQGEKQFRAEVSSIGLIQHINLVKLIGFCCKGDKRLLVYEHMVNGSLDAHLFQSKA
TILNWTTRYNIAIGVARGLSYLHQSCKECIIHCDIKPENILLDASFTPKIADFGMAAFVG
RNFSRVLTTFRGTIGYLAPEWISGVAITPKVDVYSFGMVLLEILSGKRNSQKVCTDDNSN
QVAFFPVTAISKLLEGDVRSLVDPELNGNFSLEEAERLCKVACWCIQDNEVNRPTMSEVV
RVLEGLHNFDMPPMPRLLAALAVRSDVDHCDSS
Download sequence
Identical sequences OMERI05G04420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]