SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G04440.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G04440.1
Domain Number 1 Region: 67-129
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000523
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI05G04440.1
Sequence length 297
Comment pep:novel chromosome:ALNW00000000:5:4208724:4209909:-1 gene:OMERI05G04440 transcript:OMERI05G04440.1 description:""
Sequence
MTPLINISLGLILVFLHSTTTSCAANDVLRVAQALTVGDKLVSRNGKFTLGFFQPSIVSK
SGNIISPNWYVAITMNNTTSAVLSNDGNLVIGSSSNMLWQSFDNPSDVLLPGAKFGWNKL
TGFTRQIISKKNLIDPGLGLYHVELGSKGVSLRRRNPSVVYWSWSSKKSTDKFMLISLLK
QLININPHTRGRIDIKHVDNNQEEYYTYILLDESYSIYVLLDISGQVEINIWSQLTQSLQ
KVYAQPADPCTAFGTCGPFTICNGVSRPFCDCMESFSRKSPQDWELDDRTAGCMRNT
Download sequence
Identical sequences A0A0E0DMM0
OMERI05G04440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]