SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G16930.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G16930.1
Domain Number 1 Region: 411-682
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-75
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 58-166,198-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.55e-24
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 
Weak hits

Sequence:  OMERI05G16930.1
Domain Number - Region: 385-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0373
Family Pan module (APPLE domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI05G16930.1
Sequence length 701
Comment pep:novel chromosome:ALNW00000000:5:21327099:21335100:1 gene:OMERI05G16930 transcript:OMERI05G16930.1 description:""
Sequence
MSRRRRRRRHSHGGPSAFCRREARLEERQVRARLLPATANCRHISKYINTTTTTLPGWYL
GIWFNKIPVFTIAWVANRENPITGPELKQAQLKISRDGNLAIVLNNNTSSESIIWSSTHT
IGNRTTGSSSTNTTTTTSALLMNNGNLLLMASSNVVLWQSFDYPTDVGLPGAKLGRNKIT
SLNRRFVAKKSLIDMGLGSYILEMDTNTVLRLRRRKPPVVVYWSWSSGQLAYTLVPLLNE
LLDMDPRTKALLKPAYVHNNEEEYFTYTSLDESASVFVSIDITGQFKLNVWSQPKMSWQT
IYAEPSDPCNLHDVCGPFTVCNGNSVPFCGCMESFSPNSPRDWDAGDPIGGCIRDTPLDC
STGKQKNTSSMDMFHPIARVTLPLYPQRVEDASTQSDCEEACLHDCTCIAYSYNEKLGGG
GFGSVFKGMLGDQTAIAVKRLDGAHQGEKQFRAEVSSIGMIQHINLVKLIGFCFEGDKRL
LVYERMLNGSLDAHLFQSNATVLNWSTRYQIAIGVARGLCYLHQSCSECIIHCDIKPENI
LLNESFVPKIADFGLAAIVGRDFSRVLTTFRGTVGYLAPEWLSGVAITPKVDVYSFGMVL
LEIISGRRNSPEVFASNSYHGAYFPVRAINKLHVGDVRSLMDPRLHDDFSLEEAERVCNV
ACWCIQEIESDRPTMGEVVRTIEGLQELDLFPMSRLLAAII
Download sequence
Identical sequences OMERI05G16930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]