SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI05G21770.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI05G21770.2
Domain Number 1 Region: 113-221
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.00000805
Family Plant cytotoxins 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI05G21770.2
Sequence length 225
Comment pep:novel chromosome:ALNW00000000:5:25146135:25149043:1 gene:OMERI05G21770 transcript:OMERI05G21770.2 description:""
Sequence
MKPMKIIPMWKLDELDYEDWANQKQREEDQLAFPEEDLEQKPLFVFTRDELFRCKDDPIL
VIDLSKGLTRCKLRAYCNRLLRAVSRYCTRYTAGNKIILPSHHVLSCVRVSVKVKQSKQS
IFLALDLSNLYCIGVLVNGVFYEPQKKGAKNWMMEGSRPLLIGRGVGYLGLLGEDRPALE
LTGHATTSYLMELFKLGTDRQAMGKALKAIGLFALTFLEPCRQTR
Download sequence
Identical sequences OMERI05G21770.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]