SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI06G05270.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G05270.1
Domain Number 1 Region: 507-798
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-70
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 2 Region: 64-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-28
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 
Weak hits

Sequence:  OMERI06G05270.1
Domain Number - Region: 352-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000157
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI06G05270.1
Sequence length 801
Comment pep:novel chromosome:ALNW00000000:6:4435479:4437884:-1 gene:OMERI06G05270 transcript:OMERI06G05270.1 description:""
Sequence
MRGFCIFTTVISFLLMLPTAVAKDQKSFLTRRSTISTQDDTTTILVSPNDDFSCGFYKVA
TNAFTFSIWFSRSSEKTVAWTANRDAPVNGKGSRLTFQNDGTLAFLDYNGKVVWSTNTTA
TQANRAELLNNGNLVVMDLQGQHLWRSFDSPTDTLLPLQPITRNVKLVSASARGLLYSGF
YNFLFDSNNILTLVYNGPDTASIYWPNPSVYLPWKNGRTTYDSRRYGVLNQTGHFVSSDL
FKFEASDLGDHVMRRLTLDYDGNLRLYSLNETSGNWSVSWMAFSRVCQMHGVCGINSVCN
YTPRLHCSCLRGFEVIDPTDWSKGCKRKADMTVIWDKGNRQNTNNTISQDFSFRKITGTD
FWGYDMAYAESVPFSNCRNMCLANPKCQAFGYRRGTGQCYPKYTLFNGRSFPDPYNDIYL
KVPKGVSFTKETDSRLTHSCGVTEKVAYPSSQMLQDFPSKFEFGYFLSSVLTLLLIEVVL
IIVGFSVVKKWETRPEITDEGYAIISSQFRRFSYKELRKATNCFQEELGNGGSGVVYKGV
LDDERQVAVKKLNDVIYGEQELRSELSVIGRIYHMNLVRVWGFCAEKTSRLLVSEYIENG
SLDRLLFDHQNLFPLLKWNQRYNIALGVAKGLAYLHHECLEWIVHCDIKPENILLDKDFE
PKIADFGLVKLLKQGTAQMLSRVHGTRGYIAPEWALNLPITGKADVFSYGVVLLELVKGI
RVSRWMIEGEKVELGVKRTADILKEKLVNEDQSWLLEFVDGRLEGEFNYLQAVKMLKIAV
SCVEEERSQRPSMSQVVQNLL
Download sequence
Identical sequences A0A0E0DXL5
OMERI06G05270.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]