SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI06G05280.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G05280.1
Domain Number 1 Region: 515-814
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-70
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 76-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-30
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 
Weak hits

Sequence:  OMERI06G05280.1
Domain Number - Region: 377-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0122
Family Anti-platelet protein 0.051
Further Details:      
 
Domain Number - Region: 233-280
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0157
Family Terpenoid cyclase N-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI06G05280.1
Sequence length 819
Comment pep:novel chromosome:ALNW00000000:6:4440054:4442513:-1 gene:OMERI06G05280 transcript:OMERI06G05280.1 description:""
Sequence
MRGVYIFTTSIFFLLMPTIALANHRKPILARRSSISTQAFIARRSSISTQDDTTTILVSP
NGDFSCGFYRVATNAFTFSIWFSRSSEKTVAWTANRDAPVNGKGSRLTFQKDGTLALLDY
NGKVVWSTNTTATRADRAELLNNGNLVVMDPEGQHLWRSFDSPTDTLLPLQPITRNVKLV
SASARGLLYSGFYNFLFDSNNILTLVYNGPDTASIYWPNPSFDQPWKNGRTTYDSLRYGV
LNQTGYFVSSDLFKFEASDLGDHVMRRLTLDYDGNLRLYSLNETSGNWSVSWMAFSRVCQ
MHGVCGTNAVCNYIPELHCSCLQGFEVIDPADWSKGCKRKVDITAIWDKGNRHNITNNST
SQDFSIRKITATDFWGYDTAYTQLIPYSNCRNMCLTANNCQAFGYRKGTGECYPKYSLFN
GRRFPDPYNDLYLKVPKGVPFREESDSRPTHSCGVTEKLAYPSSQMFEEVTSNFEFGYFL
SSVLTLLLIEVVLIIVGFSVVRKWETRPEITDEGYAIISSQFRRFSYKELQKATNCFQEE
LGSGGSGVVYKGVLDDERKVAVKILNDVIYGEQELRSELSVIGRIYHMNLVRIWGFCVEK
TKRLLVSEYSENGSLDRLLFDYHNLFPVLKWSQRYNIALGVAKGLAYLHHECLEWIVHCD
IKPENILLDKDFEPKIADFGLVKLLKPEAAQMLSRVHGTRGYIAPEWALNLPITGKADVY
SYGVVLLELVKGSRVSRWVVDGKEEVGLAVKRNVDTLREKLASEDQSWLLEFVDSRLDGE
FNYSQAATVLKIAVLCLEEDRRMRPSMDTVVEVLLSLVE
Download sequence
Identical sequences A0A0E0DXL7
OMERI06G05280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]