SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI06G05290.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G05290.1
Domain Number 1 Region: 499-800
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-72
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 66-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-28
Family alpha-D-mannose-specific plant lectins 0.0022
Further Details:      
 
Weak hits

Sequence:  OMERI06G05290.1
Domain Number - Region: 353-399
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00126
Family Pan module (APPLE domain) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI06G05290.1
Sequence length 805
Comment pep:novel chromosome:ALNW00000000:6:4453058:4455475:-1 gene:OMERI06G05290 transcript:OMERI06G05290.1 description:""
Sequence
MAMRGVHIFSTLISFLLMLTTALAEDKKSYLARGSSISTQDDTKTMLVSPNGDFACGFYK
VATNAFTFSIWFSRSSEKTVAWTANRDTPVNGKGSKLTFRRNGSLALVDYNGAVVWSTNT
TATGASRAELDDSGNLIVMDQAGHRLWKSFDSPTDTLLPLQPMTRDTKLVSASARGLPYS
GLYTFFFDSNNILSIIYNGPETSSIYWPNPYERSWENGRTTYNSSQYGILNQEGMFLASD
KLQFEASDLGDKDVMRRLTLDYDGNLRLYSLNATNGKWSVSWLAFPRLCEIHGLCGINSF
CTYMPSLQCSCLEGFEMTEPSDWSQGCRRKENITVKGDQNANNNTEQKFIFVEIPKTDFY
GYDFNYTPSVALPVCKQICLNDDGCEAFAYRKGKGECFPKALLINGKKFPDPSNDIYLKF
SKEASSSQLLASKPSHICKVTEKDAYPSSQMFEGSNSKFKFGYFLSSALTLLVVEVILVT
VGCWATYKWGRRPEIRDEGYTIISSQFRRFSYKELEKATGFFQEELGSGGSGAVYKGILD
DNRKVAVKKLNDVIHGEQEFRSELSIIGRVYHMNLVRIWGFCAEKTHKLLVSEFVENGSL
DRVLSNHQSVFPVLPWSQRYNIALGVAKGLAYLHHECLEWIVHCDVKPENILLDKDFEPK
IADFGLVKLLNRGPSTNILSRVHGTRGYIAPEWALNLPITGKADVYSYGVVLLELVKGNR
VSRWVVDGEEEVELAVKRTVDILKEKLASGDQSWLLDFVDCRLNGEFNYSQAALVLNTAV
SCLDEDRRKRPSMNSVVEILLSLME
Download sequence
Identical sequences A0A0E0DXL9
OMERI06G05290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]