SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI06G23550.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI06G23550.1
Domain Number 1 Region: 470-697
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-28
Family Protein kinases, catalytic subunit 0.0029
Further Details:      
 
Domain Number 2 Region: 82-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.32e-28
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI06G23550.1
Sequence length 722
Comment pep:novel chromosome:ALNW00000000:6:29127835:29130298:-1 gene:OMERI06G23550 transcript:OMERI06G23550.1 description:""
Sequence
MASTVQVHLLVTAILCVSRRCLASSDTISASSAVSGGWTVVSRGGSFELGFFRINASSSS
SRNGSYYYVGVWYKKAVSPCTPVWIANRAAPVADRATSRLAIAADGNLVLINEADELVWS
TNVSSAAAAGTVAVILDTGNLVLRRKNDVDEVVLWQSMDHPTDTWLPGARLGLNKVTGEA
QVLTAWKNSGDPASGVFSLGIDPAGTSQYFIVWNRTVPYWASGEWNGDIFAGIPEMTSHY
MYNFEFVSDANGSYFTYSLQDPAIISRFVVGVSGQITQLTWAPSADEWILIWTEPHRMCD
VHAVCGAFAVCDEKSEPLCSCLAGRLGPSTSTAAAVTGDKDDDDFLLIPGVSPPKNPSFV
RASGDRDCRSACLMDCSCNDYSYSDRCALWHGDLLNLQRQTDEDAGAGNLYLRLSAMDVP
SKSSKKTIALACAGAAAALVVALFAMAFVLARMLRRRRSMRFAQALERGILVAFRYSDVR
RATKNFSEKLGGGSFGSGKLPLDGRAAAAVAVKKLEGLRSDMGDKQFRNEVRTIGTINHV
NLVRLRGFCSGRGGERLLVYDYMPNGSLDKALFGKSAAAAWISGVPVTAKADVYSFGMVL
LEIVSGRRNARCSSASGAGGACSEYFPLVAARKVRDREVAGLLDERLDGEADMEELDRVC
RVACWCVQDEEANRPTMEQVVQALEGVIAVDVPPVPVSLKVFADDASYSFFSDECSQLKS
SS
Download sequence
Identical sequences OMERI06G23550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]