SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI07G08160.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI07G08160.1
Domain Number 1 Region: 89-332
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-44
Family Protein kinases, catalytic subunit 0.00062
Further Details:      
 
Domain Number 2 Region: 410-502
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000532
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI07G08160.1
Sequence length 515
Comment pep:novel chromosome:ALNW00000000:7:8483398:8488322:1 gene:OMERI07G08160 transcript:OMERI07G08160.1 description:""
Sequence
MGCFLSKPAGAGPLPPKDAADAAALPADNPADPEAAAANGGADSAAADGGGDDKDAAKRA
VPVFREFGLAELRAATKGFSADLIVSESGEKAPNVVYRGRLDGGRLIAVKRFSRLSWPDP
QQFLAEAAGVGKVRHKRLVNLIGCCAEGDERLLVAEYMPNDTLSKHLFHWDKQPLPWEMR
LRVAYYIAQALDHCNAENRKIYHDLNAYRVLFDEEGDPRLSSFGLMKNSRDGKSYSTNLA
YTPPEFLRTGRVIAESVIYSYGTVLLDLLSGKHIPPSHALDLIRGKNILLLMDSSLEGQY
ANEDASKLVDLASKCLQFEARDRPNIKYLLSSVGPLQKQKEVASHVLMGITKATAVLPTI
LSPLGKACSGMDLTAVHDILLKTGYKDEEGAENELSFQEWTQQVQEMLNTKKFGDIAFRD
KDFKTAIDYYSKLVGMMSVPSATVFARRSFSYLMNGQSELALRDAMQAQVCMPEWPTAFY
LQALALSKLGMETDAQDMLNDGATFEAKKQNSWRG
Download sequence
Identical sequences A0A0E0E9X4
OMERI07G08160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]