SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI07G14850.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI07G14850.1
Domain Number 1 Region: 37-347
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.54e-53
Family SGL-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI07G14850.1
Sequence length 350
Comment pep:novel chromosome:ALNW00000000:7:18133127:18134179:-1 gene:OMERI07G14850 transcript:OMERI07G14850.1 description:""
Sequence
MGAVLGTGRVGTLTRVALTIVVFLLLLPSHALAAAVAKDTSATLVETLPLPTTLVGPESV
AFDKFGDGPYSGVSDGRILRWDGADKGWTTYSHAPGYNVAKCMAPKLHPAELTESKCGRP
LGLRFHNTSGNLYIADAYKGLMRVGPRGGEATVLATEADGVPFKFTNGVDVNQVTGEVYF
TDSSTRFQRSQHERVTATGDSTGRLMKYDPTTGYLDVLQSGMTYPNGLALSADRSHLVVA
LTGPCKLMRHWIEGPKAGTSEPFAELPGYPDNVRPDGKGGYWVALHREKTESPYGSDTHL
LAVRIGRNGKILQELRGPKNVRPTEVIERGGGKLYLGSVELGHVAVVKAT
Download sequence
Identical sequences A0A0E0ECR5
OMERI07G14850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]