SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI07G15260.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI07G15260.1
Domain Number 1 Region: 527-830
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-81
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 77-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-21
Family alpha-D-mannose-specific plant lectins 0.0056
Further Details:      
 
Weak hits

Sequence:  OMERI07G15260.1
Domain Number - Region: 369-424
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000549
Family Anti-platelet protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI07G15260.1
Sequence length 865
Comment pep:novel chromosome:ALNW00000000:7:18454716:18460759:-1 gene:OMERI07G15260 transcript:OMERI07G15260.1 description:""
Sequence
MASTAAIAALALVFLLLLCARDGGGVDAADTLSQGQSLGANDTLVSANGTFKVGFFTPAG
GDPGKVYLGVMYAMSNVQTVMWVANRDAPVRTAAGAASATVTGSGELLVKEGDRVAWRTN
ASAAGRSNHTLTIRNDGNLVIAGSDAAGTDVEWESFHHPTDTFVPGMEIALRQTNGDRTL
YTSWRSDADPATGDFTLGLDASAQLYIWQSQGGKNSTYWRSGQWASGNFVGIPWRALYVY
GFKLNGDPPPIAGDMSIAFTPFNASLYRFVLRPNGVETCYMLLGSGDWELVWSQPTIPCH
RYNLCGDNAECADDNGQPICTCFEGFEPKSPQEYNNGNWTQGCVRSVPLTCSSERNNTAA
GGDGAGGGDGFTVIRGVKLPDFAVWGSLVGDANSCEKACLDSCSCGAYSYSTGSCLTWGQ
ELVDIFQFPAGTEGAKYDLYVKVPSSLLDKSSGRWKTVVVVVVVVVVVVLLASGLLMWKC
RRRIKEKLGIGTKKAQLPLLRPARDAKQDFSGPAQSEHEKSEEGKNCELPLFAFETLATA
TDNFSISNKLGEGGFGHVYKGRLPGGEDIAVKRLSRSSGQGLEEFKNEVILIAKLQHRNL
VRLLGCCIQGEEKILVYEYMPNKSLDAFLFDPERRGLLDWKTRFQIIEGVARGLLYLHRD
SRLRVVHRDLKASNILLDRDMNPKISDFGMARIFGGDQNQVNTNRVVGTLGYMSPEYAME
GLFSVRSDVYSFGILILEIITGQKNSSFHHMEGSLNIVGYAWQLWNGDRGQELIDPAIRG
TCPAKEALRCVHMALLCVQDHAHDRPDIPYVVLTLGSDSSVLPTPRPPTFTLQCTSSSSG
RDMYYRDKEESYSANDLTVTMLQGR
Download sequence
Identical sequences OMERI07G15260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]