SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI07G15290.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI07G15290.1
Domain Number 1 Region: 514-825
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-80
Family Protein kinases, catalytic subunit 0.0000861
Further Details:      
 
Domain Number 2 Region: 82-195
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.81e-20
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Weak hits

Sequence:  OMERI07G15290.1
Domain Number - Region: 300-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0153
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 373-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0251
Family Hairpin loop containing domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI07G15290.1
Sequence length 849
Comment pep:novel chromosome:ALNW00000000:7:18472687:18480009:-1 gene:OMERI07G15290 transcript:OMERI07G15290.1 description:""
Sequence
MAASPPRPLLLLLPLLLVWGVVVAAAAAATDTLRQGESLTGAATLVSSPSGVFEVGFFAP
DPKLPSRLYLGIWYRSISPRTVVWVANRAAPATASSPSLTLAANGELRVLDGSAADAPLL
WRSNASTQSAPRGGYKAVIQDTGSLEVRSDDGTLWDSFWHPSDTMLSGMRITVRTPGRGP
SEPMRFTSWTSETDPSPGRYALGLDPANSGQAYIWRDGNVTIWRSGQWTGQNFVGIPWRP
LYLYGFKPANDANLGAYYTYTASNTSLQRFVVMPNGTDICYMVKKSAQEWETVWMQPSNE
CEYYATCGANAKCTAMQDGKAKCTCLKGFQPKLLDQWNMGNWSQGCVRSPPLGCQVNQSG
DGFLSIPSIKWPDFSYWPSTVQDENGCMNACLSNCSCGAYVYITTIGCLLWGSDLIDMYQ
FQSGGYTLNLKLPASELRSHHAVWKIATIVSAVVLFVLLACLFLWWKRGRNIKDVMHKSW
RSMHTSARSQQNSGMLDISQSIPFEDDTEDGKSHELKVYSFDRIKAATCNFCDSNKLGAG
GFGPVYMGKLPGGEEVAVKRLCRKSGQGLEEFKNEVILIAKLQHRNLVRLLGCCIQGEEK
ILVYEYMPNKSLDAFLFDLEKQGLLDWRKRFDIIEGIARGLLYLHRDSRLRVVHRDLKAS
NILLDKDMNPKISDFGMARMFGGDQNQFNTNRVVGTFGYMSPEYAMEGIFSVKSDIYSFG
VLMLEIITGKRALSFHGQQDSLNIAGFAWRQWNEDKGEELIDPLIRASCSLRQVLRCIHI
ALLCVQDHAQERPDIPAVILMLSSDSSSLPMPRPPTLMLHGRSGETSKSSEKDQSHSIGT
VSMTQLHGR
Download sequence
Identical sequences A0A0E0ECX4
OMERI07G15290.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]