SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI08G04850.2 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI08G04850.2
Domain Number 1 Region: 954-1195
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-56
Family Protein kinases, catalytic subunit 0.00053
Further Details:      
 
Domain Number 2 Region: 225-452
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-52
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 3 Region: 518-620,652-679
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.02e-23
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  OMERI08G04850.2
Domain Number - Region: 823-875
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0192
Family Anti-platelet protein 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI08G04850.2
Sequence length 1237
Comment pep:novel chromosome:ALNW00000000:8:4568413:4575721:1 gene:OMERI08G04850 transcript:OMERI08G04850.2 description:""
Sequence
MDLIPIGVDQAQRGMDHYSKSFLLYLAPIRDKNYSYLMISTSYSSTSVRFVLDSSGKVQF
LSWDSGRSLWAVQYILSVQGCGRYGSCGPYGHCDLTGVHTCKCLDGFEPVSDKFVYISGI
SFEECTVLCSRNCCAQLMLTPIQRVYFHPSACYGWESLLTQQSLVKMVRINISGLPVQFW
CVKFVLDVLLYLDVGHFGHITKWPAGREKKRHDQVVYSETKKDLGETKVEFPVISFREIT
VATQYFADSNILGRGGFGNFYKGTLEGDTEIAVKRLSKSSGQGLEEFRMKNLVKLLGCCT
RGEEKILIYEYLPNKSLDAFRFNDARKFSNADARKSMLDWPTRFKIIKGVAKGLLYLHQD
SRLTVVHRDLKASNKFLDADMSPKVSDFGMARIFGSAQQQANTNRLVGTYGYMSPEYALE
GTCSVKSDISFGVLLLKIVSGLKISHPHRITDFPNLIAFLSTEDGSEPGWLSHGSIHLCA
SDNRLVPGKPLSPGSTIISDDGTFALGFFSPSNPKKHYYVGIWYNNIPKFTVVWVANRAA
PITVPSSAVFTLTRSSNLTLSDGNGHVLWTTMAKSRISISSPRNTKNISTEAMLDNTGNL
ILRSLADNAIIWQSFDHPTDTLLPGMNLRLSHNTHPPQRLISWKDIRDPSPGPFSYGADP
NNLLQRFIWHGSVPHRRSPVWNNYLLIGKYMNNLNSTIYMAINHDSDEVYMSFGMPTGPF
SVLIRMKITYLGKVNMLGWQSNISAWTTLYSEPVHDCNIYGYCGPNSYCDNTDAVPACKC
LDGFEPREEERRTNNRSFLQGCRRRKALRCHHGNSFLTYPSMKVPDNFIYIHKRSFDECM
VECRSNCSCVAYAYSNISSGIIDDTRCLLWTGELIDMEKVTQGGENLYIRTNRLNGNRKT
TDVLEFVLPAVASLLILICMLIWICGVRGKQRGDEIYGGLMLGDISTSRELSDRKVDFPI
FSFREIASATNNFSDSNILGHGGFGTVYKGTMDGDKEIAVKRLSKGSAQDASRNSALDWT
TRFKIIKGVARGILYLHQDSRLTIIHRDLKASNVLLDADMHPKISDFGTARIFGGNEQQS
NTNRVVGTYGYMAPEYALEGIISVKSDVYSFGVLLLEIVSGLKISGIIDPTTGHSNLIAY
AWSLWKNGNMSSFVDSSISESSSLNEALRCVHIALLSIQNNPNARPLMSWVVSSLDNKDI
ELPEPKEPMYFAHRSYGADGAGESFVNDMSIATVEAR
Download sequence
Identical sequences OMERI08G04850.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]