SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI08G06850.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI08G06850.1
Domain Number 1 Region: 55-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000327
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Domain Number 2 Region: 151-253
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000903
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 3 Region: 467-557
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000624
Family Protein kinases, catalytic subunit 0.0096
Further Details:      
 
Weak hits

Sequence:  OMERI08G06850.1
Domain Number - Region: 276-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI08G06850.1
Sequence length 576
Comment pep:novel chromosome:ALNW00000000:8:7248748:7250478:-1 gene:OMERI08G06850 transcript:OMERI08G06850.1 description:""
Sequence
MGAQINETTIPQCSEINTAGPQSWVSPSGRLAFGFYPEGEGFSIGVWLVTDPSRFIMWTA
FRNDPPVSGGSILLTACGSLQWIPPNQGFQGKVISAAPTSATSAAILDTSNFVLYDAKKQ
VIWSIFGIPTDTLLPGQNLPPGNQLFSSVSDTNHATGKYRLSNQPDGNLVMYPIGAIDPD
SAYWNTGTYAQNFLLTLTLDSNGTLWLFDRNSQYRMVLFLTNQSLSASPESESYYHLTLD
ADGILRLYSHVFFKQGGAPKTKVEWLVPPSNDRCSVKGVCGPNSFCQVTSSGETSCSCLP
GFEFLSANQSTQGCWRAQTGGCTGNSPNGDIGLVVVATMVTVKNTSWSDRSYNIPPQSPT
IEECKAICMSDCACEIAMFDSYCSKQMLPIRYGKRVPGSNTTLFVKVYSYEPKRTASATS
TAMLTSGAALAMLSLVLLSVSVMLCKRRPFLRYTRAPQHHETEFDEESIGIRPYSFHDLE
LSTDGFAEELGRGAYGTVFKGVLTNSGNKGIAVKRLERMAEDGEREFKRDVFIVRFFQEI
KLLSAKYTVFGVLYMEYSNHVSKGWNGQIAIGSINP
Download sequence
Identical sequences A0A0E0EJF4
OMERI08G06850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]