SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI09G01520.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI09G01520.1
Domain Number 1 Region: 171-340
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.000000000255
Family Plant cytotoxins 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI09G01520.1
Sequence length 397
Comment pep:novel chromosome:ALNW00000000:9:2561835:2568190:-1 gene:OMERI09G01520 transcript:OMERI09G01520.1 description:""
Sequence
MAPGDHPFCSISGDAGSRAAATPPLPGIACVLEFTTVVVGASARLDLPLHPRRCMVLHAC
CSAARAGMASSISGAEHLDCEAQHDSFVDRRSEDDTVYVNCEARRSIRDEDLAKRKSGST
SMARSLVLRNTRSSSAGYSFFAPGMLGFRRYMSSIRETLGGAYLELPTPRNTMTFSLDGS
PQEVLNNYKRLINEIRLWSYWNGLRVDVSPLYGKKKFVYTTAERGSLYLAVKERTNSAVF
VIEGRGLWLKGFWTKNGLYEMLPNAHEDSFIDHPRCKFLRFEGNYISIGAGEPGRTEIGL
HKLRKALHSVIQYRGVSPEPEHFRTSINLFIQYLCEAPKLDSNPVIFPENRLTNCDMGMP
MDLCNMARVCAPQLGIPRFASGNTDITKRCSLAILGS
Download sequence
Identical sequences OMERI09G01520.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]