SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI09G06300.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI09G06300.1
Domain Number 1 Region: 45-96,125-301,329-365
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 8.94e-40
Family SGL-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI09G06300.1
Sequence length 373
Comment pep:novel chromosome:ALNW00000000:9:10099740:10103176:1 gene:OMERI09G06300 transcript:OMERI09G06300.1 description:""
Sequence
MWPCLSPRAAVLIALLLLPAAMASSAAAAAGHGAEEMKSIYAGPKVVPVRLGRPAFGPES
LAFDHRGGGPYTGVSNGRVLRWRADRRRPGWTEFAHNYKHATVAECAARKKAAAAAAAAA
AESVCGRPLGVQFDRRTGEMYIADAYLGLMRVGRRGGMAEVVAAEAGGVALNFVNGVDVD
QATGDVYFTDSSTTDYLLVVLSGDATGRLLRYEPRTGNVTVLESGLAFPNGVAVSADGTH
LVVAETASCRLLRHWLRGSNAGATEVLADLPGYPDNVRPAADDDDVVDGGRGASYWVALN
RDKAWTVNGTTPASVAAVRVVVDGGGGAGGGKVDVALRGFGGATVSEVVERNGSLWFGSV
DTPYVGLLKLASL
Download sequence
Identical sequences OMERI09G06300.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]