SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI09G09820.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI09G09820.1
Domain Number 1 Region: 520-845
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.02e-71
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 76-159,186-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-17
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Weak hits

Sequence:  OMERI09G09820.1
Domain Number - Region: 368-412
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0196
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI09G09820.1
Sequence length 910
Comment pep:novel chromosome:ALNW00000000:9:13972491:13975223:-1 gene:OMERI09G09820 transcript:OMERI09G09820.1 description:""
Sequence
MPPSRSLACLLLPLLLLLESVRDADAGPLAVEIVRPSFTATSYDYVDTGGAFLVSRNGAF
RAAVFNPGKQQASFYLAVLHAPSGTPVWSGNRDAPTSSTGKVQLSVGGITVSDTNGAVLW
STPPLRSPVAALRLQDTGDLQLLDAGNATLWRSFDNATDTLLPGQQLLAGAYLSSAKGAT
DFSQGDYRFGVITADVLLTWQGSTYWRLSNDARGYKDTNAAVASMSVNASGLFAVAADGA
LVFRVSLAPAEFRMLKLGSDGRLRIISYALVNSSAPVGGDFVAPAGDCDLPLQCPSLGYC
SPAGNGSTCTCPPLFAASVTVADSCTPGDGSTLASPAACQNNDSSGGGGGSVSYIALKPL
TSYFATKFDAPTNTGVNKTACRALCTASCACLGFFHDSVSLSCRLLGGKQLGSLYKGASD
TNLGYIKTFNSATKAGSNQIGSSSANHTVPIVLPSVAAFLLLAVLGWYLWWRNKMSKNGK
KKKGKSSTMKVYLGRQKSPSRDTGYNADADDGDGDDDDDIVIPGMPARFSYQEITTMTSN
FATKVGSGGFGTVYKGELPGGEGLIAVKKLEAAGAQAKREFCTEITIIGNIRHVNLVRLR
GFCAEGSRRLLVYEYMNRGSLDRSLFGRTGPVLEWGERMEVAVGAARGLAYLHTGCEQKI
VHCDVKPENILLADGGQVKISDFGLAKLMSREQSALFTTMRGTRGYLAPEWISNAAISDR
ADVYSFGMVLLELIHGRKNRGEQEAAAANNVAVAAGSGEHSDLPSGWSSAMTSTASGTSG
GGDEYFPMVALELHEQRRYLDLVDARLEGRVDEAEAARTVRVALCCLHEDPALRPSMATV
VRILEGSVPPPEPRVEALGFLRLYGRSYPLPVPGSLTTMAGTTASAAGSSSTAGGGSHLD
ESLKDTSAPR
Download sequence
Identical sequences A0A0E0ESX1
OMERI09G09820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]