SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI09G14140.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI09G14140.1
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-28
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  OMERI09G14140.1
Domain Number - Region: 301-330
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0177
Family Hairpin loop containing domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI09G14140.1
Sequence length 345
Comment pep:novel chromosome:ALNW00000000:9:17643374:17644411:-1 gene:OMERI09G14140 transcript:OMERI09G14140.1 description:""
Sequence
MYLGIWYNDIPGRTVVWVADRGTPVTNSSSSLPTLSLTNSSNLVLSDADGRVRWTSNITE
DAEGSGSTAVLNNDGNLVVRSPNGTTLWQSFEHPTDSFLPGMKLGMTFKTRVSDRLVSWR
GPNDPSQGSFSVAGDPDTFLQVFVRNGTRLISRDGPWTGYMVSSQYQANSSDIFYFSVVN
NDEKRYITFSVSEGSPYTRYVITYAGKYQFQRWNISSSAWNVEEWPRWDCDYYNYCGPNG
YCDSTARAPAVPTCKCLFGFEPSNAAEWNSGRFSRGCRRKEAVRCGDRFLAVPGMKSPDK
FVHVPNRTLDACAAECSNNCSCVAYAYANLSSSISMGDMTRCLVW
Download sequence
Identical sequences A0A0E0EUK7
OMERI09G14140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]