SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI09G14210.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI09G14210.1
Domain Number 1 Region: 436-718
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-81
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 64-156,188-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.1e-27
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  OMERI09G14210.1
Domain Number - Region: 352-403
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Hairpin loop containing domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OMERI09G14210.1
Sequence length 767
Comment pep:novel chromosome:ALNW00000000:9:17675196:17678843:-1 gene:OMERI09G14210 transcript:OMERI09G14210.1 description:""
Sequence
MDRSDAFTYIIISVVVVVLLPPPCSSDDRLVPGKPLTSDATVVSDGGAFAMGFFSPSNST
PDKLYLGIWYNDIPVRTVVWVANQETPVTNGTTLSLTDSSDLVVSGADGRVRWAANVTGG
AAGSGNTTAVLMNTGNLVVRSPNGTALWQSFEHPTDSFLPGMKLRMTYSTRASDRLVSWR
GPGDPSPGSFSYGGDTDTFLQVFMWNGTRPVMRDGPWTGDVVDGQYQTNSTAINYLAILS
RDDEVSIEFAVPAGAPHTRYALTYAGEYQLQRWSAASSAWSVLQEWPTGCGRYGHCGANG
YCDNTAAPVPTCRCLAGFEPAASAGCRRTVAVRCGDGFLAVVGMKPPDKFVRVANVATLE
ACAAECSGNCSCVAYAYANLSSSRSRGDTTRCLVWSGDLIDTAKRRNRQKHRELILDVTS
TSDDVGKRNLVQDFEFLSVKFEDIALATHNFSEAYKIGEGGFGKVYKAMIGGQEVAVKRL
SKDSQQGTEEFRNEVILIAKLQHRNLVRLLGCCVERDEKLLIYEYLPNKGLDATLFDGSR
KPKLDWTMRFNIIKGVARGLLYLHQDSRLTIIHRDLKASNVLLDAEMRPKIADFGMARIF
CDNQQNANTRRVVGTYGYMAPEYAMEGIFSTKSDVYSFGVLLLEVITGIRRSSTSNILDF
PNLIIYAWNMWKEGKTKNLVESSIIDSCLLDEVLLCIHVALLCVQENPNDRPLMSSTVFI
LENGSSTALPAPSRPAYFAYRSDESEQSRENIQNSMNTFTLTNIEGR
Download sequence
Identical sequences OMERI09G14210.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]