SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI10G04530.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI10G04530.1
Domain Number 1 Region: 482-768
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-75
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 62-156,188-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-29
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  OMERI10G04530.1
Domain Number - Region: 349-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00216
Family Pan module (APPLE domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI10G04530.1
Sequence length 800
Comment pep:novel chromosome:ALNW00000000:10:6585814:6588302:-1 gene:OMERI10G04530 transcript:OMERI10G04530.1 description:""
Sequence
MSLLLCFLLFSLYPPRISAATDTVSPGHALTGSDRLVSNNSKFVLGFFKTESKNSSYASH
NSYLCIWYSKLPMITPLWSANGENPVVDPASPELAISSDGNMVILDQVTKNIIWSTHVNT
RTNHTIVVLLNNGNLVLQSSSNSSKVFWQSFDYPTDSLFAGAKIFRNKVTGQKNRLVSRK
NSIDQAAGLYSVEFDINGTGHLLWNSTVVYWSTGDWNGHFFGLAPEMIGATIPNFTYVNN
DREVYLSYTLTKEKITHAGIDVNGRGLAGIWLDSLQNWLINYRMPILHCDVYAICGPFSV
CNDSNNPFCDCLKGFSIRSPKDWDLEDRSGGCMRNTPLNCGSTMNKNGFTDKFYCVQNII
LPHNAMSVQTAGSKDQCSEVCLSNCSCTAYSYGKGGCSVWHDALYNVRQQSDGSADGNGE
TLYIRVAANEVQSVERKKKSGTVIGVTIAASMSALCLMIFVLVFWRRKQKWFSHGVENAQ
EGIGIRAFRYTDLQCATKNFSEKLGGGSFGSVFKGYLNDSIIIAVKRLDGACQGVKQFRA
EVNSIGIIQHINLVKLIGLCCEDGKKLLVYEYMTNRSLDVHLFKDNDKVLEWNIRYQIAI
GVAKGLAYLHDSCRDCIIHCDIKPENILLDASFVPKIADFGMAKVLGREFSHALTTVRGT
IGYLAPEWISGTVVTSKVDVYSYGMVLFEIISGRRNSNQEYCRGHSAYFPMQVARQLING
GIGNLVDAKLHGDVNLEEVERVCKVACWCIQDSEFDRPTMGEVVQFLEGLLELKMPPLPR
LLNAITGGLHSTSLLPIDLQ
Download sequence
Identical sequences A0A0E0EWS6
OMERI10G04530.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]