SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI10G04560.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI10G04560.1
Domain Number 1 Region: 487-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-76
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 63-157,189-218
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.72e-30
Family alpha-D-mannose-specific plant lectins 0.002
Further Details:      
 
Weak hits

Sequence:  OMERI10G04560.1
Domain Number - Region: 351-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000451
Family Pan module (APPLE domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OMERI10G04560.1
Sequence length 807
Comment pep:novel chromosome:ALNW00000000:10:6602633:6605162:-1 gene:OMERI10G04560 transcript:OMERI10G04560.1 description:""
Sequence
MSVLLGFLLLLSLHPPTSYATTDTVSPGQTLAGGDRLISNNSKFALGFFKMDSKNSSYTS
RNSYLCIWYNKLPMITPLWSANGENPVVDPASPELTISGDGNMVIMDQDTKSIIWSTRVN
TTTNGTVVVLLNDGNLVLQSSSNSSMAFWQSFDYPTDSLFADAKIGWNKVTGLNRRLVSR
KNSIDQAAGLYSLEFDINGVGHLVWNSTVTYWSSGDWNGQFFGSAPEMFGATIPNFTFVN
NDTEVYLTYTLNNEKAITHAAIDVNGRGLAGVWLDSLQDWLINYRMPLLHCDVYAICGPF
TVCNDNNDPFCDCMKGFSIRSPKDWEIEDRTGGCMRNTPLNCGSTMNKTGFRDKFYYVQN
IILPRNAMHVQEAASKDECSDVCLSNCSCTAYSYGKGGCSVWHDELYNVRQQSDASADGN
GDNFYIRLAANEVHEVQSAERKKKSGVIIGVAIGASTAAFCLMILLLMFWRRKGKLFARG
AENDQGSIGITAFRYIDLQRATKNFSEKLGGGSFGSVFKGYLNESTPIAAKRLDGTCQGE
KQFRAEVDSIGMIQHINLVKLIGLCCEGDKKLLVYEYMPNGSLDVQLFKDNDKVLDWNLR
YQIAIGVARGLAYLHDSCRDCIIHCDIKPENILLNESFVPKIADFGMAKILGREFSHALT
TMRGTIGYLAPEWISGTVVTAKVDVYSYGMVLFEILSGRRNSSQEYFKDGDHSAYFPMQV
ARQLINGGIGNLVDAKLHGDVNLDEAERVCKIACWCIQDSEFDRPTMGEVVQFLEGVLEL
KTPPLPRLLNAITGGSHSTPLSSLDLP
Download sequence
Identical sequences A0A0E0EWS8
OMERI10G04560.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]