SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI10G13860.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI10G13860.1
Domain Number 1 Region: 57-340
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.09e-46
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Domain Number 2 Region: 414-510
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000135
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI10G13860.1
Sequence length 519
Comment pep:novel chromosome:ALNW00000000:10:16511069:16515782:1 gene:OMERI10G13860 transcript:OMERI10G13860.1 description:""
Sequence
MGCCGSSLRVGSHAPEKPPRRARPPPPPPQPHHPRRPSFTLNAHQAASSSSAAPCPAFAE
FSLAELREATGGFAAANIVSESGEKAPNLVYRGRLQGAGGGGRAIAVKKFGKLAWPDPKQ
FAEEARGVGKLRHRRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWENKAIEWAMRLR
VAYNIAEALEYCSNEERPLYHDLNAYRVLFDENGDPRLSCFGLMKNSRDGKSYSTNLAYT
PPEYLRNGRVTPESVVFSFGTILIDLLSGKRIPPTHALDMIRSRSIQAIMETNLEGKYSI
EEATTLVDLASKCLQYEPRDRPDIKKLVSILQPLQTKSEVPSYVMLGVPKPEEVPKAPPA
PQHPLSPMGEACSRMDLTAIHQILVSTHYRDDEGTNELSFQEWTQQMRDMLDARKRGDFA
FRDKNFKQAIDCYTQFVDVGTMVSPTVYARRSLCHLMCDQPDAALRDAMQAQCVYPDWPT
AFYMQAVALSKLNMQSDSLDMLNEASQLEEKRQKSIKGP
Download sequence
Identical sequences A0A0E0F0J0
OMERI10G13860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]