SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI11G02850.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G02850.1
Domain Number 1 Region: 93-166,266-290
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000691
Family alpha-D-mannose-specific plant lectins 0.009
Further Details:      
 
Weak hits

Sequence:  OMERI11G02850.1
Domain Number - Region: 373-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00381
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI11G02850.1
Sequence length 507
Comment pep:novel chromosome:ALNW00000000:11:2445060:2446583:1 gene:OMERI11G02850 transcript:OMERI11G02850.1 description:""
Sequence
MRLAKGDPAIAGVVAALCVASAVMVAVVDGAKGDGRVTQLSNGFTARHSPDAPAPFEPVL
YAANGAFAFGFLRVGAASLDLAVVHLASSFPLWRASPARVGDWSRPATLTFDTGLVLAGA
DDDAGVLWQTLNAIGDTVVLLNSSNLVVRRFAETRPAWQSFDNPSDTLVLDQNLTVSSPP
LISGNRRFALRLAKTYMSLHMEFYGGRATPMYWQHTALEAQPENATQPPVYGCLDGRGFF
GLYLQGSGEKVDVLSFDTFVQNLTGAFRRMTLEDDGNLRAYYWTDDAKAWTPDYKAITAP
CELPTSCGAYGLCVPGGGEAKCQCLTNSTATSPPCSAEETTDLCGDGDNDGGQVFDEVRL
KRVSVAYKERLPFETNATAEQCEQACAGNCSCWGAVHSGASGYCYLLDFPVETMVYEADD
QKVGYFKVRRPPRSSTRQGMSPGAKAVTAALSLILASLAVAGAYVGHRLWQRRQRRRRAG
GMEQELTSSGPYKDLKSMGSSNSSFKS
Download sequence
Identical sequences A0A0E0F2L6
OMERI11G02850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]