SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI11G05220.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI11G05220.1
Domain Number 1 Region: 2753-3014
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-67
Family Protein kinases, catalytic subunit 0.0003
Further Details:      
 
Domain Number 2 Region: 38-338
Classification Level Classification E-value
Superfamily L domain-like 4.08e-60
Family Polygalacturonase inhibiting protein PGIP 0.0048
Further Details:      
 
Domain Number 3 Region: 334-683
Classification Level Classification E-value
Superfamily RNI-like 3.61e-58
Family Cyclin A/CDK2-associated p19, Skp2 0.065
Further Details:      
 
Domain Number 4 Region: 1993-2196
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-25
Family Protein kinases, catalytic subunit 0.0078
Further Details:      
 
Domain Number 5 Region: 759-866
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-24
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 6 Region: 1557-1659,1691-1716
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-18
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Domain Number 7 Region: 2245-2347,2379-2396
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.5e-17
Family alpha-D-mannose-specific plant lectins 0.0086
Further Details:      
 
Domain Number 8 Region: 980-1051
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000209
Family F-box domain 0.0042
Further Details:      
 
Domain Number 9 Region: 1051-1192,1239-1336
Classification Level Classification E-value
Superfamily RNI-like 0.0000000366
Family Rna1p (RanGAP1), N-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI11G05220.1
Sequence length 3278
Comment pep:novel chromosome:ALNW00000000:11:4967510:4995617:-1 gene:OMERI11G05220 transcript:OMERI11G05220.1 description:""
Sequence
MATTSSACVSIAVLVVVLSSTSCYSSPSPTTTANGSSDTDLAALLAFKSQLTDPLGVLTS
NWSTSTSFCHWRGVTCSRRRRHRRVTGLSLPHTPLHGPITPLLGNLSFLSFLRLTNTNLT
ASIPADLGKLRRLRHLCLGENSLSGGIPPDLGNLARLEVLELGSNQLSGQIPPELLLHLH
NLQVISLEGNSLSGQIPPFLFNNTPSLRYLSFGNNSLSGPIPDGVASLSQLEILDMQYNQ
LSSLVPQALYNMSWLRVMALAGNGNLTGPIPNNNQTFRLPMLRFISLAQNRIAGRFPAGI
ASCQYLREIYLYSNSFVDVLPTWLAKLSRLEVVSLGGNNLVGTIPAVLSNLTRLAVLELS
FGNLVGNIPPEIGLLQKLVYLFLSANQLSGSVPWTLGNIVALQKLVLSHNNLEGNMGFLS
SLSECRHLEDLVLDHNSFVGALPDHLGNLSARLISFIADHNKLTDHNSFIPEKMSNLSSL
ELIDLGYNQLTGAIPESIATMRNVGLLDALCQTQIGTLLNLQRLFLERNKISGSIPDSIG
NLSRLDYIDLSNNQLSGKIPASLFQLHNLIQINLSCNSIVGALPADIAGLRQIDQIDVSS
NFLNGSIPESLGQLNMLTYLILSHNSLEGSIPSTLQSLTSLTWLDLSSNNLSGSIPMFLE
NLTDLTMLNLSFNRLEGPIPEGGIFSNNLTRQSLIGNAGLCGSPRLGFSPCLKKSHPYSR
PLLKLLLPAILVASGILAVFLYLMFEKKHKKAKAYGDMADVIGPQLLSYHDLVLATENFS
DDNLLGSGGFGKVFKGQLGSGLVVAIKVLDMKLEHSIRIFDAECHILRMARHRNLIKILN
TCSNMDFKALVLEFMPNGSLEKLLHCSLNSGVEDGRTCRPSHRRWHVVDGGTRRLYPIRA
GLLEDAAPRLPTPPPATPPQKSPGEALRSSTAPRRAEDRREVEAATHRLVKPGDHPISST
VPRLRPPPVRRNVSYGPSEECGIDDLPDELLQQILSLLFADEAVKTCVLSRRWRHLWKST
DILRVAFSTERWKSSDEFKKFVNHLVLLRGISPLRELDLRFNARRYEDVVHDGGSDPYQC
VMLWVMYAVMCRVQVLKIHNLDQIDIEVYKGMPLVSPHLTKIELSGMELKNCFLNFSSCP
ALKELYFTKNCSFDSVYEIVSRSIQCIHIFHCQFSEYHRTVIYAPSLITFFLEGYCGRTP
FLGIMPSLVEASVRPHQDCDDSCSNSYCGNCEDEYCDGCHCSYEVSDDSESVLLGGLTEA
ENLKLIAGPNIFIFRSDLRWCPLFSKLKCLLLNEWCLASNFSALACILEHSPVLRKLTLK
ISKEYKSMVELETEENDNSLWKPAAISEHLKVVKVHCKEVDEGVYKIGKWLSTLDIKVII
KQRKQSPKRRYKWGHVQSCVVEYSNWELQLQASKSSSLERQLAIALLGLWSLTKCRCSIS
TVKLASIFLYISPHTPKSQQHLILHPCCYLSNPSSATFSNISMSPLHTHLGFFLLLLFSL
HNPSCSAAVNDTLAAGQVLAVGEKLVSRNGKFALGFYKPALPEGIASKYGNITSPGWYLA
IWFNKIPVCTTVWVANRERPITDLEIKLTQLRFSQDGSSLAIIINHATGSTVWSTEIANR
TAQAKTSMNTSAILLDSGNLVIESLPDAYLWQSFDNATDLALPGAKFGWNKITRLHRTGT
SKKNLIDPGLGSYSVQLNERGIILWRRDPYMEYWTWSSVQLTNMLIPLLNSLLKMNAQTR
GFLTPYYVNNDEEEYFMYHSSDESSSSFVSIDMSGQLKLSIWSQANQSWQEVYAQPPDPC
TPFATCGPFSICNGNADLFCDCMESFSQKSPQDWELKDRTAGCFRNTPLDCPSNRSSTDM
FHTITRVALPANPEKIEDATTQSKCAESCLSNCSCNAYAYKDNTCFVWHSELLNVKLHDS
IESLSEDTLYLRLAAKDMPATTKNKQKTVVVAVIAASIVGFGLLMLVLFFLIWRNKFKCC
GVTLHHNQGSSGIIAFRYTDLSHATKNFSEKLGSGGFGSVFKGVLRDSTTIAVKRLDGSH
QGEKQFRAETLGWRHLWEGILVGGTKGYLAPEWLSGVAITPKVDVYSFGMVLLEIISGRR
NLSEAYTSNHYHFDYFPVQAISKLHEGSVQNLLDPELHGDFNLEEAERVCKVACWCIQEN
EIDRPTMGEVVRFLEGLREVDMPPMPRLFAAITESLLFEQIESSNLLAVGKKLISRNGKF
ALGFFKPTLPEDAGSKYENIASPGWYLAIWFNKIPVCTTVWVANRKRPITDHELKLAQLK
FSQDGSSLAIIRNRATESTVWSVQIANRTAQAKTSMNTSAVLLDSGNLVIESLPNVYLWQ
SFDDATDLVLPGAKFGWNKVTGLHRTGISKKNLIDPGLTSYSVQLNERDFILWRRDPYME
YLTWSSVQLTNMLIPLHNSQLEMNSQTGGFLTPSYVNNDEEEYFIYHSSDELASSFVSID
MSGQLKLSIWSQANQYWQEVYAHPTDPCALFATCGPFSFCIATCGPFGVCDGNRKPFCDC
MEGFSPKCHAQKFSNRIPSRMCIKIPVQDQPGYTNDNVDIQIHEDARGRGRQSKAAAMAV
LTGARRGGGVTKSPQDWELMDRTAGCFRNTPLDCSSNRSSTDMFLAICRGVLPTNHKIVE
DATTQSKYEEACLSNCFCIAYAYEDSTCYAWRGELLNLRLQDSIESLSEDTLYLRLAAKD
MPASTKNKRKPVPAAVTIASIIGFGLLMLLLLFLIWQNKLKCCGVPLHHTQGNSGIVAFR
YTDLSHATKNFSEKLGSGGFGSVFKGVLSDSTTIAVKRLDGLHQGEKQFRAEVRSLGLIQ
HVNLVKLIGFCYEGDKRLLVYEHMINGSLEAHLFHSNGAILDWSTRHQIAIGVARGLSYL
HESCHECIIHYDIKPENILVEASFAPKIADFGMAAFVRRDFSRVLTTFRGTKGYLAPEWL
SGVAITPKVDVYRFGMVLLEIISGRRNLSEAYTSNHYHFDYFPVQAISKLHEGSVQNLLD
PELHGDFNLEEAKRGLSAEHSTSPTRPFPFLTPLAPVGGGFVARTSPTARFLPPLSTPNP
KALSLRLPASPRGILRGSLGRGGVGDGAPSLPTAVASTPTASTTMPRRNRRGGGEGHRAA
ARVSLRRAVGSPHLQLAHPPPSPRLPNHPCYLSLFTRSFLCYFPANLRFVFLCIHSEHDS
HDSQAKATKKGKKQELCHSLIEEENCNFTGSMQVVVYVLTGIDLLHSCECWEGQATVLSP
LIFRNGAANILLTNKYKILLKEYNKIEALKVMLIRKTI
Download sequence
Identical sequences OMERI11G05220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]