SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OMERI12G01220.1 from Oryza meridionalis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OMERI12G01220.1
Domain Number 1 Region: 516-817
Classification Level Classification E-value
Superfamily Aldolase 8.79e-89
Family HMGL-like 0.00052
Further Details:      
 
Domain Number 2 Region: 36-233
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 3.24e-29
Family SGL-like 0.025
Further Details:      
 
Domain Number 3 Region: 233-367
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.87e-20
Family Serum paraoxonase/arylesterase 1, PON1 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OMERI12G01220.1
Sequence length 927
Comment pep:novel chromosome:ALNW00000000:12:913998:922000:1 gene:OMERI12G01220 transcript:OMERI12G01220.1 description:""
Sequence
MNTTAKLLALAVFAAAAILSLDSRSDVRQLEIRDGDVELIPLLDGAAGPESIVFDDAGEG
PYTSVSDGRILKWLPPPERRWVEHSCSVPELLDSCRGSKDTKREQECGRPLGLKFNSKTG
ELYVADAYLGLRVVSPGENVSRPLVPKWTESPFSFSNGVEIDHETGVIYFTETSTRFQRR
EFLNIVITGDNTGRLLKYDPKENKVEVLVDGLRFPNGLAMSNDGSYLLLAETTTVDGLRF
PNGLAMSNDGSYLLFAETTTGKILRYWIKTPKASTIEEVAQLPGFPDNIKMSPRGGFWVG
LHAKRGKIAEWSISYPWLRKVIALRLSEDGKITETMSVHGDVRKLFKSISEVEEKDGNLW
IGSQKSKPPSQHSCIPRNPRCHVPIRAPPLTHTHITEKQSKCISISHHLIRFDSPKPLES
STPQTPATTMASSLLSSPKPSSFSSANPTSTPRPRAQTLSPFRAAAPRFSHGLAAAAAAA
NPSASRRCYHRAFARPVRASMAQPRRPEYVPNRIDDPNYVRIFDTTLRDGEQSPGATMTS
AEKLVVARQLARLGVDIIEAGFPASSPDDLDAVRSIAIEVGNTPVGEDGHVPVICGLSRC
NKRDIDAAWEAVRHARRPRIHTFIATSEIHMQHKLRKTPEQVVAIAKEMVAYARSLGCPD
VEFSPEDAGRSNREFLYHILEEVIKAGATTLNIPDTVGYTLPYEFGKLIADIKANTPGIE
NAIISTHCQNDLGLATANTLAGAHAGARQLEVTINGIGERAGNASLEEVVMAIKCRRELL
GGLYTGINTQHITMSSKMVQEHSGLHVQPHKAIVGANAFAHESGIHQDGMLKYKGTYEII
SPDDIGLTRANEFGIVLGKLSGRHAVRSKLVELGYEITDKEFEDFFKRYKEVAEKKKRVT
DEDIEALLSDEIFQPKVFWSLADVQWL
Download sequence
Identical sequences OMERI12G01220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]